BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0295.Seq (605 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 1.8 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 22 4.1 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 22 4.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 5.4 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 9.4 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +2 Query: 251 DIVAGIRRTVSLRVASHRPA 310 +++A + T+ + V SHRPA Sbjct: 9 EVIAAVLLTILIFVTSHRPA 28 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.2 bits (45), Expect = 4.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 107 EMWIDRNALV*LQSVLRSNPQTR 175 EM +DR L L+S++ NP+ R Sbjct: 325 EMKMDRTELGCLRSIILFNPEVR 347 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.2 bits (45), Expect = 4.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 107 EMWIDRNALV*LQSVLRSNPQTR 175 EM +DR L L+S++ NP+ R Sbjct: 325 EMKMDRTELGCLRSIILFNPEVR 347 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 160 QPTDPSCSERPRPTRTSDATR 222 QPT CS+R RP + + + Sbjct: 875 QPTMNKCSDRKRPASQATSVK 895 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/36 (22%), Positives = 16/36 (44%) Frame = +3 Query: 135 YSSSQYCDPTHRPELQREASSYANQRRDATRYRSNL 242 Y + ++ TH ++ +Y RD RY ++ Sbjct: 1082 YQTLKHIIQTHGEMTDKQVEAYMLSLRDENRYHEDI 1117 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,209 Number of Sequences: 438 Number of extensions: 2928 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17848938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -