BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0291.Seq (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 3.6 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 22 4.7 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 22 4.7 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 4.7 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 22 4.7 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 8.2 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 8.2 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 3.6 Identities = 9/35 (25%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -3 Query: 291 QRATRDASLSAVRCLFIVRTESTMRVPG-SVWRAI 190 Q+ D ++S F+V + + +PG S+W + Sbjct: 345 QKPVADVAVSGPGLAFLVYPSAVLELPGSSIWSCL 379 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.8 bits (44), Expect = 4.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 170 PRPIRIRNAVDCLTRVS 120 P PIR+ +D + R++ Sbjct: 453 PHPIRVAKTIDVIARIT 469 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.8 bits (44), Expect = 4.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 170 PRPIRIRNAVDCLTRVS 120 P PIR+ +D + R++ Sbjct: 439 PHPIRVAKTIDVIARIT 455 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.8 bits (44), Expect = 4.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 170 PRPIRIRNAVDCLTRVS 120 P PIR+ +D + R++ Sbjct: 473 PHPIRVAKTIDVIARIT 489 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.8 bits (44), Expect = 4.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 170 PRPIRIRNAVDCLTRVS 120 P PIR+ +D + R++ Sbjct: 422 PHPIRVAKTIDVIARIT 438 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 325 DRCSPSQANSPGP 363 DR SPS + SP P Sbjct: 34 DRRSPSSSRSPSP 46 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.0 bits (42), Expect = 8.2 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +2 Query: 2 CHAPGVY 22 CH+PGVY Sbjct: 299 CHSPGVY 305 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,724 Number of Sequences: 438 Number of extensions: 3324 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -