BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0291.Seq (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20350.1 68418.m02421 zinc finger (DHHC type) family protein ... 29 1.5 At5g52090.1 68418.m06466 tRNA-splicing endonuclease positive eff... 29 2.0 At3g59110.1 68416.m06590 protein kinase family protein contains ... 28 3.6 At3g23890.1 68416.m03002 DNA topoisomerase, ATP-hydrolyzing / DN... 28 4.7 At5g47455.3 68418.m05859 expressed protein 27 6.2 At5g37150.1 68418.m04460 tRNA-splicing endonuclease positive eff... 27 6.2 At2g43680.2 68415.m05430 calmodulin-binding family protein simil... 27 6.2 At2g43680.1 68415.m05429 calmodulin-binding family protein simil... 27 6.2 At2g37260.1 68415.m04571 WRKY family transcription factor (TTG2)... 27 6.2 At5g47455.6 68418.m05857 expressed protein 27 8.3 At5g47455.5 68418.m05855 expressed protein 27 8.3 At5g47455.4 68418.m05860 expressed protein 27 8.3 At5g47455.2 68418.m05858 expressed protein 27 8.3 At5g47455.1 68418.m05856 expressed protein 27 8.3 At5g37030.1 68418.m04441 tRNA-splicing endonuclease positive eff... 27 8.3 At2g21840.1 68415.m02595 CHP-rich zinc finger protein, putative 27 8.3 >At5g20350.1 68418.m02421 zinc finger (DHHC type) family protein / ankyrin repeat family protein similar to patsas protein [Drosophila melanogaster] GI:6002770; contains Pfam profiles PF00023: Ankyrin repeat, PF01529: DHHC zinc finger domain Length = 592 Score = 29.5 bits (63), Expect = 1.5 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -1 Query: 365 TGPGLLAWLGLQRSSKAIFVFH-LSRSEPPATRL 267 TG G LAWLG ++ +F+F+ SR +P R+ Sbjct: 279 TGIGALAWLGFILATAGLFLFYRCSRKDPGYIRM 312 >At5g52090.1 68418.m06466 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 676 Score = 29.1 bits (62), Expect = 2.0 Identities = 12/44 (27%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = -3 Query: 318 GHFRVPPVTQRATRDASLSAVR-CLFIVRTESTMRVPGSVWRAI 190 G+ +V + R + +L+ R CL+++ E+T+ + GS+W + Sbjct: 583 GNGKVGFLNNRQRANVALTRARHCLWVIGNETTLALSGSIWATL 626 >At3g59110.1 68416.m06590 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 512 Score = 28.3 bits (60), Expect = 3.6 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -3 Query: 351 VGLARAAAVLEGHFRVPPVTQRATRDASLSAVRCL 247 VG RA V++ PP T RA + A L A+RC+ Sbjct: 411 VGTRRAEEVVDSRIEPPPAT-RALKRALLVALRCV 444 >At3g23890.1 68416.m03002 DNA topoisomerase, ATP-hydrolyzing / DNA topoisomerase II / DNA gyrase (TOP2) identical to SP|P30182 DNA topoisomerase II (EC 5.99.1.3) {Arabidopsis thaliana} Length = 1473 Score = 27.9 bits (59), Expect = 4.7 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -3 Query: 546 WYSXSFWTXSRXGSGKSGCTFTIV-MFEEPRSTSI 445 WY T + S + GCT+TI ++EE T+I Sbjct: 880 WYRGFKGTIEKTASKEGGCTYTITGLYEEVDETTI 914 >At5g47455.3 68418.m05859 expressed protein Length = 106 Score = 27.5 bits (58), Expect = 6.2 Identities = 19/61 (31%), Positives = 28/61 (45%) Frame = -1 Query: 542 IPSRSGPXPGLEAXSQAAPSQLXCSKSLVRLRFYCGASVLGSAGCMXGSXRTARGLRPVT 363 IPS+ P PS+L C +SL+ L A+ L S C+ + R++R L Sbjct: 43 IPSKPAASPLPRFSFSRCPSELGCVQSLLPLHSTVAAARLTS--CLSTTSRSSRALTQEM 100 Query: 362 G 360 G Sbjct: 101 G 101 >At5g37150.1 68418.m04460 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 839 Score = 27.5 bits (58), Expect = 6.2 Identities = 10/37 (27%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -3 Query: 297 VTQRATRDASLSAVR-CLFIVRTESTMRVPGSVWRAI 190 + R + +L+ R CL+++ E+T+ + GS+W + Sbjct: 753 LNNRQRANVALTRARHCLWVIGNETTLALSGSIWATL 789 >At2g43680.2 68415.m05430 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 669 Score = 27.5 bits (58), Expect = 6.2 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 2/69 (2%) Frame = +1 Query: 232 RPYDEQTPHG*QRRVAGGSLRDRWNTKMAFEDRCSPSQANSPGPVT--GRSPRAVRXDPX 405 +P+D P A +LR +T++ + R +P SP P + G SP+A+ P Sbjct: 160 KPFDRSKPSSASAN-APPTLRPA-STRVPSQ-RITPHSVPSPRPSSPRGASPQAISSKPP 216 Query: 406 IQPAEPSTL 432 AEP TL Sbjct: 217 SPRAEPPTL 225 >At2g43680.1 68415.m05429 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 668 Score = 27.5 bits (58), Expect = 6.2 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 2/69 (2%) Frame = +1 Query: 232 RPYDEQTPHG*QRRVAGGSLRDRWNTKMAFEDRCSPSQANSPGPVT--GRSPRAVRXDPX 405 +P+D P A +LR +T++ + R +P SP P + G SP+A+ P Sbjct: 159 KPFDRSKPSSASAN-APPTLRPA-STRVPSQ-RITPHSVPSPRPSSPRGASPQAISSKPP 215 Query: 406 IQPAEPSTL 432 AEP TL Sbjct: 216 SPRAEPPTL 224 >At2g37260.1 68415.m04571 WRKY family transcription factor (TTG2) contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 349 Score = 27.5 bits (58), Expect = 6.2 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -2 Query: 337 GCSGPRRPFSCST--CHAASHPRRVSVSREVFVHRKDGEHN 221 G + PR + C++ C A H R S F+ +G+HN Sbjct: 284 GNAYPRSYYRCTSANCRARKHVERASDDPRAFITTYEGKHN 324 >At5g47455.6 68418.m05857 expressed protein Length = 100 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = -1 Query: 542 IPSRSGPXPGLEAXSQAAPSQLXCSKSLVRLRFYCGASVLGSAGCMXGSXRTARGL 375 IPS+ P PS+L C +SL+ L A+ L S C+ + R++R L Sbjct: 43 IPSKPAASPLPRFSFSRCPSELGCVQSLLPLHSTVAAARLTS--CLSTTSRSSRAL 96 >At5g47455.5 68418.m05855 expressed protein Length = 108 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = -1 Query: 542 IPSRSGPXPGLEAXSQAAPSQLXCSKSLVRLRFYCGASVLGSAGCMXGSXRTARGL 375 IPS+ P PS+L C +SL+ L A+ L S C+ + R++R L Sbjct: 43 IPSKPAASPLPRFSFSRCPSELGCVQSLLPLHSTVAAARLTS--CLSTTSRSSRAL 96 >At5g47455.4 68418.m05860 expressed protein Length = 116 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = -1 Query: 542 IPSRSGPXPGLEAXSQAAPSQLXCSKSLVRLRFYCGASVLGSAGCMXGSXRTARGL 375 IPS+ P PS+L C +SL+ L A+ L S C+ + R++R L Sbjct: 43 IPSKPAASPLPRFSFSRCPSELGCVQSLLPLHSTVAAARLTS--CLSTTSRSSRAL 96 >At5g47455.2 68418.m05858 expressed protein Length = 104 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = -1 Query: 542 IPSRSGPXPGLEAXSQAAPSQLXCSKSLVRLRFYCGASVLGSAGCMXGSXRTARGL 375 IPS+ P PS+L C +SL+ L A+ L S C+ + R++R L Sbjct: 43 IPSKPAASPLPRFSFSRCPSELGCVQSLLPLHSTVAAARLTS--CLSTTSRSSRAL 96 >At5g47455.1 68418.m05856 expressed protein Length = 100 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = -1 Query: 542 IPSRSGPXPGLEAXSQAAPSQLXCSKSLVRLRFYCGASVLGSAGCMXGSXRTARGL 375 IPS+ P PS+L C +SL+ L A+ L S C+ + R++R L Sbjct: 43 IPSKPAASPLPRFSFSRCPSELGCVQSLLPLHSTVAAARLTS--CLSTTSRSSRAL 96 >At5g37030.1 68418.m04441 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 638 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/34 (32%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 297 VTQRATRDASLSAVR-CLFIVRTESTMRVPGSVW 199 ++ R + +L+ R CL+++ EST+ GS+W Sbjct: 574 LSNRQRANVALTRARHCLWVIGNESTLARSGSIW 607 >At2g21840.1 68415.m02595 CHP-rich zinc finger protein, putative Length = 746 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -2 Query: 319 RPFSCSTCHAASHPRRVSVSREVFV 245 + FSC TC HP + V R + V Sbjct: 548 KAFSCVTCEDIYHPMCIQVGRRILV 572 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,060,430 Number of Sequences: 28952 Number of extensions: 216890 Number of successful extensions: 690 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 674 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 690 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -