BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0285.Seq (429 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC005174-1|AAH05174.1| 282|Homo sapiens activating transcriptio... 54 2e-07 AF305687-1|AAG22558.1| 282|Homo sapiens transcription factor AT... 54 2e-07 AF101388-1|AAD28370.1| 122|Homo sapiens activating transcriptio... 54 2e-07 AB073613-1|BAD38650.1| 282|Homo sapiens activating transcriptio... 54 2e-07 AB021663-1|BAA78477.2| 282|Homo sapiens leucine-zipper protein ... 54 2e-07 M86842-1|AAA52071.1| 351|Homo sapiens cAMP response element reg... 52 8e-07 D90209-1|BAA14234.1| 351|Homo sapiens DNA binding protein TAXRE... 52 8e-07 CR456384-1|CAG30270.1| 351|Homo sapiens ATF4 protein. 52 8e-07 BC073990-1|AAH73990.1| 351|Homo sapiens activating transcriptio... 52 8e-07 BC073754-1|AAH73754.1| 351|Homo sapiens activating transcriptio... 52 8e-07 BC044895-1|AAH44895.1| 351|Homo sapiens activating transcriptio... 52 8e-07 BC024775-1|AAH24775.1| 351|Homo sapiens activating transcriptio... 52 8e-07 BC022088-1|AAH22088.1| 351|Homo sapiens activating transcriptio... 52 8e-07 BC016855-1|AAH16855.1| 351|Homo sapiens activating transcriptio... 52 8e-07 BC011994-1|AAH11994.1| 351|Homo sapiens activating transcriptio... 52 8e-07 BC008090-1|AAH08090.1| 351|Homo sapiens activating transcriptio... 52 8e-07 AL022312-4|CAB45284.1| 351|Homo sapiens activating transcriptio... 52 8e-07 CR450353-1|CAG29349.1| 351|Homo sapiens ATF4 protein. 50 3e-06 L05913-1|AAC37526.1| 475|Homo sapiens cAMP responsive element b... 41 0.002 L05912-1|AAC37527.1| 369|Homo sapiens cAMP responsive element b... 41 0.002 L05911-1|AAC37525.1| 501|Homo sapiens cAMP responsive element b... 41 0.002 L05515-1|AAA52072.1| 508|Homo sapiens cAMP response element-bin... 41 0.002 BC059400-1|AAH59400.2| 369|Homo sapiens cAMP responsive element... 41 0.002 AB209262-1|BAD92499.1| 368|Homo sapiens cAMP responsive element... 41 0.002 X57197-1|CAA40483.1| 494|Homo sapiens ATFa protein. 39 0.006 X52943-1|CAA37118.1| 483|Homo sapiens protein ( Human mRNA for ... 39 0.006 L19871-1|AAA20506.1| 181|Homo sapiens activating transcription ... 35 0.13 CR450334-1|CAG29330.1| 181|Homo sapiens ATF3 protein. 35 0.13 BT006996-1|AAP35642.1| 181|Homo sapiens activating transcriptio... 35 0.13 BC117491-1|AAI17492.1| 127|Homo sapiens Jun dimerization protei... 35 0.13 BC117489-1|AAI17490.1| 127|Homo sapiens Jun dimerization protei... 35 0.13 BC006322-1|AAH06322.1| 181|Homo sapiens activating transcriptio... 35 0.13 AY426987-1|AAQ93358.1| 181|Homo sapiens activating transcriptio... 35 0.13 AL591647-4|CAI17048.1| 127|Homo sapiens Jun dimerization protei... 35 0.13 AL590648-5|CAH72657.1| 124|Homo sapiens activating transcriptio... 35 0.13 AL590648-4|CAH72656.1| 181|Homo sapiens activating transcriptio... 35 0.13 AL590648-3|CAH72655.1| 175|Homo sapiens activating transcriptio... 35 0.13 AF255346-1|AAF73966.1| 127|Homo sapiens Jun dimerization protei... 35 0.13 BC051303-1|AAH51303.1| 163|Homo sapiens jun dimerization protei... 34 0.23 AB077880-1|BAB83896.1| 163|Homo sapiens jun dimerization protei... 34 0.23 AC009363-1|AAF21148.1| 96|Homo sapiens jdp2 protein. 33 0.31 DQ128105-1|AAZ42189.1| 272|Homo sapiens HCF-binding transcripti... 33 0.54 BC093798-1|AAH93798.1| 272|Homo sapiens CREBZF protein protein. 33 0.54 BC093796-1|AAH93796.1| 272|Homo sapiens CREBZF protein protein. 33 0.54 BC060807-1|AAH60807.1| 354|Homo sapiens CREB/ATF bZIP transcrip... 33 0.54 AF039942-1|AAD28325.1| 272|Homo sapiens HCF-binding transcripti... 33 0.54 EU012025-1|ABR92635.1| 415|Homo sapiens TRIM39-like protein pro... 29 6.7 BX248580-8|CAM25901.1| 226|Homo sapiens tripartite motif-contai... 29 6.7 BX248580-7|CAM25899.1| 488|Homo sapiens tripartite motif-contai... 29 6.7 BX248580-6|CAM25900.1| 518|Homo sapiens tripartite motif-contai... 29 6.7 BX248580-5|CAM25898.1| 261|Homo sapiens tripartite motif-contai... 29 6.7 BT007370-1|AAP36034.1| 488|Homo sapiens tripartite motif-contai... 29 6.7 BC034985-1|AAH34985.1| 488|Homo sapiens tripartite motif-contai... 29 6.7 BC007661-1|AAH07661.1| 488|Homo sapiens TRIM39 protein protein. 29 6.7 AL773535-8|CAM25729.1| 226|Homo sapiens tripartite motif-contai... 29 6.7 AL773535-7|CAI41818.1| 518|Homo sapiens tripartite motif-contai... 29 6.7 AL773535-6|CAI41819.1| 488|Homo sapiens tripartite motif-contai... 29 6.7 AL773535-5|CAM25728.1| 261|Homo sapiens tripartite motif-contai... 29 6.7 AL662832-14|CAO72128.1| 226|Homo sapiens tripartite motif-conta... 29 6.7 AL662832-13|CAI17502.1| 518|Homo sapiens tripartite motif-conta... 29 6.7 AL662832-12|CAI17501.1| 488|Homo sapiens tripartite motif-conta... 29 6.7 AL662832-11|CAO72127.1| 261|Homo sapiens tripartite motif-conta... 29 6.7 AL662795-8|CAM25558.1| 226|Homo sapiens tripartite motif-contai... 29 6.7 AL662795-7|CAI18252.1| 518|Homo sapiens tripartite motif-contai... 29 6.7 AL662795-6|CAI18251.1| 488|Homo sapiens tripartite motif-contai... 29 6.7 AL662795-5|CAM25557.1| 261|Homo sapiens tripartite motif-contai... 29 6.7 AB209284-1|BAD92521.1| 352|Homo sapiens tripartite motif-contai... 29 6.7 AB202089-1|BAE78608.1| 518|Homo sapiens tripartite motif-contai... 29 6.7 AB110938-1|BAD13704.1| 518|Homo sapiens TRIM39 protein protein. 29 6.7 AB110937-1|BAD13703.1| 518|Homo sapiens TRIM39 protein protein. 29 6.7 AB046381-1|BAB16374.1| 518|Homo sapiens testis-abundant finger ... 29 6.7 >BC005174-1|AAH05174.1| 282|Homo sapiens activating transcription factor 5 protein. Length = 282 Score = 54.0 bits (124), Expect = 2e-07 Identities = 26/67 (38%), Positives = 43/67 (64%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 DR+ + ++QN + A RYRQ K+ L E Q L R+ EL E+ ++REI+Y+K L+ Sbjct: 209 DRKQKKRDQNKSAALRYRQRKRAEGEALEGECQGLEARNRELKERAESVEREIQYVKDLL 268 Query: 65 RDLFKAK 45 +++KA+ Sbjct: 269 IEVYKAR 275 >AF305687-1|AAG22558.1| 282|Homo sapiens transcription factor ATFx protein. Length = 282 Score = 54.0 bits (124), Expect = 2e-07 Identities = 26/67 (38%), Positives = 43/67 (64%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 DR+ + ++QN + A RYRQ K+ L E Q L R+ EL E+ ++REI+Y+K L+ Sbjct: 209 DRKQKKRDQNKSAALRYRQRKRAEGEALEGECQGLEARNRELKERAESVEREIQYVKDLL 268 Query: 65 RDLFKAK 45 +++KA+ Sbjct: 269 IEVYKAR 275 >AF101388-1|AAD28370.1| 122|Homo sapiens activating transcription factor 5 protein. Length = 122 Score = 54.0 bits (124), Expect = 2e-07 Identities = 26/67 (38%), Positives = 43/67 (64%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 DR+ + ++QN + A RYRQ K+ L E Q L R+ EL E+ ++REI+Y+K L+ Sbjct: 49 DRKQKKRDQNKSAALRYRQRKRAEGEALEGECQGLEARNRELKERAESVEREIQYVKDLL 108 Query: 65 RDLFKAK 45 +++KA+ Sbjct: 109 IEVYKAR 115 >AB073613-1|BAD38650.1| 282|Homo sapiens activating transcription factor 5 protein. Length = 282 Score = 54.0 bits (124), Expect = 2e-07 Identities = 26/67 (38%), Positives = 43/67 (64%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 DR+ + ++QN + A RYRQ K+ L E Q L R+ EL E+ ++REI+Y+K L+ Sbjct: 209 DRKQKKRDQNKSAALRYRQRKRAEGEALEGECQGLEARNRELKERAESVEREIQYVKDLL 268 Query: 65 RDLFKAK 45 +++KA+ Sbjct: 269 IEVYKAR 275 >AB021663-1|BAA78477.2| 282|Homo sapiens leucine-zipper protein protein. Length = 282 Score = 54.0 bits (124), Expect = 2e-07 Identities = 26/67 (38%), Positives = 43/67 (64%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 DR+ + ++QN + A RYRQ K+ L E Q L R+ EL E+ ++REI+Y+K L+ Sbjct: 209 DRKQKKRDQNKSAALRYRQRKRAEGEALEGECQGLEARNRELKERAESVEREIQYVKDLL 268 Query: 65 RDLFKAK 45 +++KA+ Sbjct: 269 IEVYKAR 275 >M86842-1|AAA52071.1| 351|Homo sapiens cAMP response element regulatory protein protein. Length = 351 Score = 52.0 bits (119), Expect = 8e-07 Identities = 26/68 (38%), Positives = 41/68 (60%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 D++ + EQN ATRYRQ K+ L E + L +++ L E+ L +EI+YLK L+ Sbjct: 279 DKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLI 338 Query: 65 RDLFKAKG 42 ++ KA+G Sbjct: 339 EEVRKARG 346 >D90209-1|BAA14234.1| 351|Homo sapiens DNA binding protein TAXREB67 protein. Length = 351 Score = 52.0 bits (119), Expect = 8e-07 Identities = 26/68 (38%), Positives = 41/68 (60%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 D++ + EQN ATRYRQ K+ L E + L +++ L E+ L +EI+YLK L+ Sbjct: 279 DKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLI 338 Query: 65 RDLFKAKG 42 ++ KA+G Sbjct: 339 EEVRKARG 346 >CR456384-1|CAG30270.1| 351|Homo sapiens ATF4 protein. Length = 351 Score = 52.0 bits (119), Expect = 8e-07 Identities = 26/68 (38%), Positives = 41/68 (60%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 D++ + EQN ATRYRQ K+ L E + L +++ L E+ L +EI+YLK L+ Sbjct: 279 DKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLI 338 Query: 65 RDLFKAKG 42 ++ KA+G Sbjct: 339 EEVRKARG 346 >BC073990-1|AAH73990.1| 351|Homo sapiens activating transcription factor 4 (tax-responsive enhancer element B67) protein. Length = 351 Score = 52.0 bits (119), Expect = 8e-07 Identities = 26/68 (38%), Positives = 41/68 (60%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 D++ + EQN ATRYRQ K+ L E + L +++ L E+ L +EI+YLK L+ Sbjct: 279 DKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLI 338 Query: 65 RDLFKAKG 42 ++ KA+G Sbjct: 339 EEVRKARG 346 >BC073754-1|AAH73754.1| 351|Homo sapiens activating transcription factor 4 (tax-responsive enhancer element B67) protein. Length = 351 Score = 52.0 bits (119), Expect = 8e-07 Identities = 26/68 (38%), Positives = 41/68 (60%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 D++ + EQN ATRYRQ K+ L E + L +++ L E+ L +EI+YLK L+ Sbjct: 279 DKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLI 338 Query: 65 RDLFKAKG 42 ++ KA+G Sbjct: 339 EEVRKARG 346 >BC044895-1|AAH44895.1| 351|Homo sapiens activating transcription factor 4 (tax-responsive enhancer element B67) protein. Length = 351 Score = 52.0 bits (119), Expect = 8e-07 Identities = 26/68 (38%), Positives = 41/68 (60%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 D++ + EQN ATRYRQ K+ L E + L +++ L E+ L +EI+YLK L+ Sbjct: 279 DKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLI 338 Query: 65 RDLFKAKG 42 ++ KA+G Sbjct: 339 EEVRKARG 346 >BC024775-1|AAH24775.1| 351|Homo sapiens activating transcription factor 4 (tax-responsive enhancer element B67) protein. Length = 351 Score = 52.0 bits (119), Expect = 8e-07 Identities = 26/68 (38%), Positives = 41/68 (60%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 D++ + EQN ATRYRQ K+ L E + L +++ L E+ L +EI+YLK L+ Sbjct: 279 DKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLI 338 Query: 65 RDLFKAKG 42 ++ KA+G Sbjct: 339 EEVRKARG 346 >BC022088-1|AAH22088.1| 351|Homo sapiens activating transcription factor 4 (tax-responsive enhancer element B67) protein. Length = 351 Score = 52.0 bits (119), Expect = 8e-07 Identities = 26/68 (38%), Positives = 41/68 (60%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 D++ + EQN ATRYRQ K+ L E + L +++ L E+ L +EI+YLK L+ Sbjct: 279 DKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLI 338 Query: 65 RDLFKAKG 42 ++ KA+G Sbjct: 339 EEVRKARG 346 >BC016855-1|AAH16855.1| 351|Homo sapiens activating transcription factor 4 (tax-responsive enhancer element B67) protein. Length = 351 Score = 52.0 bits (119), Expect = 8e-07 Identities = 26/68 (38%), Positives = 41/68 (60%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 D++ + EQN ATRYRQ K+ L E + L +++ L E+ L +EI+YLK L+ Sbjct: 279 DKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLI 338 Query: 65 RDLFKAKG 42 ++ KA+G Sbjct: 339 EEVRKARG 346 >BC011994-1|AAH11994.1| 351|Homo sapiens activating transcription factor 4 (tax-responsive enhancer element B67) protein. Length = 351 Score = 52.0 bits (119), Expect = 8e-07 Identities = 26/68 (38%), Positives = 41/68 (60%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 D++ + EQN ATRYRQ K+ L E + L +++ L E+ L +EI+YLK L+ Sbjct: 279 DKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLI 338 Query: 65 RDLFKAKG 42 ++ KA+G Sbjct: 339 EEVRKARG 346 >BC008090-1|AAH08090.1| 351|Homo sapiens activating transcription factor 4 (tax-responsive enhancer element B67) protein. Length = 351 Score = 52.0 bits (119), Expect = 8e-07 Identities = 26/68 (38%), Positives = 41/68 (60%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 D++ + EQN ATRYRQ K+ L E + L +++ L E+ L +EI+YLK L+ Sbjct: 279 DKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLI 338 Query: 65 RDLFKAKG 42 ++ KA+G Sbjct: 339 EEVRKARG 346 >AL022312-4|CAB45284.1| 351|Homo sapiens activating transcription factor 4 (tax-responsiveene protein. Length = 351 Score = 52.0 bits (119), Expect = 8e-07 Identities = 26/68 (38%), Positives = 41/68 (60%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 D++ + EQN ATRYRQ K+ L E + L +++ L E+ L +EI+YLK L+ Sbjct: 279 DKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLI 338 Query: 65 RDLFKAKG 42 ++ KA+G Sbjct: 339 EEVRKARG 346 >CR450353-1|CAG29349.1| 351|Homo sapiens ATF4 protein. Length = 351 Score = 50.0 bits (114), Expect = 3e-06 Identities = 25/68 (36%), Positives = 40/68 (58%) Frame = -2 Query: 245 DRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 D++ + EQN ATRYRQ K+ L E + L +++ L E+ L +E +YLK L+ Sbjct: 279 DKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKETQYLKDLI 338 Query: 65 RDLFKAKG 42 ++ KA+G Sbjct: 339 EEVRKARG 346 >L05913-1|AAC37526.1| 475|Homo sapiens cAMP responsive element binding protein protein. Length = 475 Score = 41.1 bits (92), Expect = 0.002 Identities = 23/61 (37%), Positives = 35/61 (57%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKAL 69 D+RR + E+N ATR RQ +K V L K+ + L Q + +L + S L+ E+ LK L Sbjct: 342 DERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQL 401 Query: 68 M 66 + Sbjct: 402 L 402 >L05912-1|AAC37527.1| 369|Homo sapiens cAMP responsive element binding protein protein. Length = 369 Score = 41.1 bits (92), Expect = 0.002 Identities = 23/61 (37%), Positives = 35/61 (57%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKAL 69 D+RR + E+N ATR RQ +K V L K+ + L Q + +L + S L+ E+ LK L Sbjct: 236 DERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQL 295 Query: 68 M 66 + Sbjct: 296 L 296 >L05911-1|AAC37525.1| 501|Homo sapiens cAMP responsive element binding protein protein. Length = 501 Score = 41.1 bits (92), Expect = 0.002 Identities = 23/61 (37%), Positives = 35/61 (57%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKAL 69 D+RR + E+N ATR RQ +K V L K+ + L Q + +L + S L+ E+ LK L Sbjct: 368 DERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQL 427 Query: 68 M 66 + Sbjct: 428 L 428 >L05515-1|AAA52072.1| 508|Homo sapiens cAMP response element-binding protein protein. Length = 508 Score = 41.1 bits (92), Expect = 0.002 Identities = 23/61 (37%), Positives = 35/61 (57%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKAL 69 D+RR + E+N ATR RQ +K V L K+ + L Q + +L + S L+ E+ LK L Sbjct: 375 DERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQL 434 Query: 68 M 66 + Sbjct: 435 L 435 >BC059400-1|AAH59400.2| 369|Homo sapiens cAMP responsive element binding protein 5 protein. Length = 369 Score = 41.1 bits (92), Expect = 0.002 Identities = 23/61 (37%), Positives = 35/61 (57%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKAL 69 D+RR + E+N ATR RQ +K V L K+ + L Q + +L + S L+ E+ LK L Sbjct: 236 DERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQL 295 Query: 68 M 66 + Sbjct: 296 L 296 >AB209262-1|BAD92499.1| 368|Homo sapiens cAMP responsive element binding protein 5 isoform beta variant protein. Length = 368 Score = 41.1 bits (92), Expect = 0.002 Identities = 23/61 (37%), Positives = 35/61 (57%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKAL 69 D+RR + E+N ATR RQ +K V L K+ + L Q + +L + S L+ E+ LK L Sbjct: 235 DERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQL 294 Query: 68 M 66 + Sbjct: 295 L 295 >X57197-1|CAA40483.1| 494|Homo sapiens ATFa protein. Length = 494 Score = 39.1 bits (87), Expect = 0.006 Identities = 21/61 (34%), Positives = 35/61 (57%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKAL 69 D+RR R E+N A+R RQ +K V L K+ + L ++ +L + + L+ E+ LK L Sbjct: 343 DERRQRFLERNRAAASRCRQKRKLWVSSLEKKAEELTSQNIQLSNEVTLLRNEVAQLKQL 402 Query: 68 M 66 + Sbjct: 403 L 403 >X52943-1|CAA37118.1| 483|Homo sapiens protein ( Human mRNA for ATF-a transcription factor. ). Length = 483 Score = 39.1 bits (87), Expect = 0.006 Identities = 21/61 (34%), Positives = 35/61 (57%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKAL 69 D+RR R E+N A+R RQ +K V L K+ + L ++ +L + + L+ E+ LK L Sbjct: 332 DERRQRFLERNRAAASRCRQKRKLWVSSLEKKAEELTSQNIQLSNEVTLLRNEVAQLKQL 391 Query: 68 M 66 + Sbjct: 392 L 392 >L19871-1|AAA20506.1| 181|Homo sapiens activating transcription factor 3 protein. Length = 181 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYL 78 D+R+ R +E+N A + R KK L KE + L + EL + +L+ E ++L Sbjct: 86 DERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHL 142 >CR450334-1|CAG29330.1| 181|Homo sapiens ATF3 protein. Length = 181 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYL 78 D+R+ R +E+N A + R KK L KE + L + EL + +L+ E ++L Sbjct: 86 DERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHL 142 >BT006996-1|AAP35642.1| 181|Homo sapiens activating transcription factor 3 protein. Length = 181 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYL 78 D+R+ R +E+N A + R KK L KE + L + EL + +L+ E ++L Sbjct: 86 DERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHL 142 >BC117491-1|AAI17492.1| 127|Homo sapiens Jun dimerization protein p21SNFT protein. Length = 127 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/63 (28%), Positives = 34/63 (53%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKAL 69 DDR+ R +E+N A R R+ + L +E ++L Q +T L + L E+++L Sbjct: 35 DDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEA 94 Query: 68 MRD 60 +++ Sbjct: 95 LKE 97 >BC117489-1|AAI17490.1| 127|Homo sapiens Jun dimerization protein p21SNFT protein. Length = 127 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/63 (28%), Positives = 34/63 (53%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKAL 69 DDR+ R +E+N A R R+ + L +E ++L Q +T L + L E+++L Sbjct: 35 DDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEA 94 Query: 68 MRD 60 +++ Sbjct: 95 LKE 97 >BC006322-1|AAH06322.1| 181|Homo sapiens activating transcription factor 3 protein. Length = 181 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYL 78 D+R+ R +E+N A + R KK L KE + L + EL + +L+ E ++L Sbjct: 86 DERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHL 142 >AY426987-1|AAQ93358.1| 181|Homo sapiens activating transcription factor 3 protein. Length = 181 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYL 78 D+R+ R +E+N A + R KK L KE + L + EL + +L+ E ++L Sbjct: 86 DERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHL 142 >AL591647-4|CAI17048.1| 127|Homo sapiens Jun dimerization protein p21SNFT protein. Length = 127 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/63 (28%), Positives = 34/63 (53%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKAL 69 DDR+ R +E+N A R R+ + L +E ++L Q +T L + L E+++L Sbjct: 35 DDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEA 94 Query: 68 MRD 60 +++ Sbjct: 95 LKE 97 >AL590648-5|CAH72657.1| 124|Homo sapiens activating transcription factor 3 protein. Length = 124 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYL 78 D+R+ R +E+N A + R KK L KE + L + EL + +L+ E ++L Sbjct: 29 DERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHL 85 >AL590648-4|CAH72656.1| 181|Homo sapiens activating transcription factor 3 protein. Length = 181 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYL 78 D+R+ R +E+N A + R KK L KE + L + EL + +L+ E ++L Sbjct: 86 DERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHL 142 >AL590648-3|CAH72655.1| 175|Homo sapiens activating transcription factor 3 protein. Length = 175 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYL 78 D+R+ R +E+N A + R KK L KE + L + EL + +L+ E ++L Sbjct: 86 DERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHL 142 >AF255346-1|AAF73966.1| 127|Homo sapiens Jun dimerization protein p21SNFT protein. Length = 127 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/63 (28%), Positives = 34/63 (53%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYLKAL 69 DDR+ R +E+N A R R+ + L +E ++L Q +T L + L E+++L Sbjct: 35 DDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEA 94 Query: 68 MRD 60 +++ Sbjct: 95 LKE 97 >BC051303-1|AAH51303.1| 163|Homo sapiens jun dimerization protein 2 protein. Length = 163 Score = 33.9 bits (74), Expect = 0.23 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 2/68 (2%) Frame = -2 Query: 275 PSRLKTRL--VDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSD 102 P +K+ L ++RR R +E+N A R R KK L +E + L + EL + + Sbjct: 61 PQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEE 120 Query: 101 LQREIRYL 78 L++E + L Sbjct: 121 LKQERQQL 128 >AB077880-1|BAB83896.1| 163|Homo sapiens jun dimerization protein 2 protein. Length = 163 Score = 33.9 bits (74), Expect = 0.23 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 2/68 (2%) Frame = -2 Query: 275 PSRLKTRL--VDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSD 102 P +K+ L ++RR R +E+N A R R KK L +E + L + EL + + Sbjct: 61 PQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEE 120 Query: 101 LQREIRYL 78 L++E + L Sbjct: 121 LKQERQQL 128 >AC009363-1|AAF21148.1| 96|Homo sapiens jdp2 protein. Length = 96 Score = 33.5 bits (73), Expect = 0.31 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = -2 Query: 248 DDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQREIRYL 78 ++RR R +E+N A R R KK L +E + L + EL + +L++E + L Sbjct: 5 EERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKQERQQL 61 >DQ128105-1|AAZ42189.1| 272|Homo sapiens HCF-binding transcription factor Zhangfei protein. Length = 272 Score = 32.7 bits (71), Expect = 0.54 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -2 Query: 164 LLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 L E Q LR + ELG++ LQ E RYL+A++ Sbjct: 157 LAAENQELRAENRELGKRVQALQEESRYLRAVL 189 >BC093798-1|AAH93798.1| 272|Homo sapiens CREBZF protein protein. Length = 272 Score = 32.7 bits (71), Expect = 0.54 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -2 Query: 164 LLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 L E Q LR + ELG++ LQ E RYL+A++ Sbjct: 157 LAAENQELRAENRELGKRVQALQEESRYLRAVL 189 >BC093796-1|AAH93796.1| 272|Homo sapiens CREBZF protein protein. Length = 272 Score = 32.7 bits (71), Expect = 0.54 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -2 Query: 164 LLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 L E Q LR + ELG++ LQ E RYL+A++ Sbjct: 157 LAAENQELRAENRELGKRVQALQEESRYLRAVL 189 >BC060807-1|AAH60807.1| 354|Homo sapiens CREB/ATF bZIP transcription factor protein. Length = 354 Score = 32.7 bits (71), Expect = 0.54 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -2 Query: 164 LLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 L E Q LR + ELG++ LQ E RYL+A++ Sbjct: 239 LAAENQELRAENRELGKRVQALQEESRYLRAVL 271 >AF039942-1|AAD28325.1| 272|Homo sapiens HCF-binding transcription factor Zhangfei protein. Length = 272 Score = 32.7 bits (71), Expect = 0.54 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -2 Query: 164 LLKEEQTLRQRHTELGEKCSDLQREIRYLKALM 66 L E Q LR + ELG++ LQ E RYL+A++ Sbjct: 157 LAAENQELRAENRELGKRVQALQEESRYLRAVL 189 >EU012025-1|ABR92635.1| 415|Homo sapiens TRIM39-like protein protein. Length = 415 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 91 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 149 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 150 RDLAHLAA 157 >BX248580-8|CAM25901.1| 226|Homo sapiens tripartite motif-containing 39 protein. Length = 226 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 108 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 166 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 167 RDLAHLAA 174 >BX248580-7|CAM25899.1| 488|Homo sapiens tripartite motif-containing 39 protein. Length = 488 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >BX248580-6|CAM25900.1| 518|Homo sapiens tripartite motif-containing 39 protein. Length = 518 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >BX248580-5|CAM25898.1| 261|Homo sapiens tripartite motif-containing 39 protein. Length = 261 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >BT007370-1|AAP36034.1| 488|Homo sapiens tripartite motif-containing 39 protein. Length = 488 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >BC034985-1|AAH34985.1| 488|Homo sapiens tripartite motif-containing 39 protein. Length = 488 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >BC007661-1|AAH07661.1| 488|Homo sapiens TRIM39 protein protein. Length = 488 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >AL773535-8|CAM25729.1| 226|Homo sapiens tripartite motif-containing 39 protein. Length = 226 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 108 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 166 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 167 RDLAHLAA 174 >AL773535-7|CAI41818.1| 518|Homo sapiens tripartite motif-containing 39 protein. Length = 518 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >AL773535-6|CAI41819.1| 488|Homo sapiens tripartite motif-containing 39 protein. Length = 488 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >AL773535-5|CAM25728.1| 261|Homo sapiens tripartite motif-containing 39 protein. Length = 261 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >AL662832-14|CAO72128.1| 226|Homo sapiens tripartite motif-containing 39 protein. Length = 226 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 108 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 166 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 167 RDLAHLAA 174 >AL662832-13|CAI17502.1| 518|Homo sapiens tripartite motif-containing 39 protein. Length = 518 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >AL662832-12|CAI17501.1| 488|Homo sapiens tripartite motif-containing 39 protein. Length = 488 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >AL662832-11|CAO72127.1| 261|Homo sapiens tripartite motif-containing 39 protein. Length = 261 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >AL662795-8|CAM25558.1| 226|Homo sapiens tripartite motif-containing 39 protein. Length = 226 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 108 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 166 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 167 RDLAHLAA 174 >AL662795-7|CAI18252.1| 518|Homo sapiens tripartite motif-containing 39 protein. Length = 518 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >AL662795-6|CAI18251.1| 488|Homo sapiens tripartite motif-containing 39 protein. Length = 488 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >AL662795-5|CAM25557.1| 261|Homo sapiens tripartite motif-containing 39 protein. Length = 261 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >AB209284-1|BAD92521.1| 352|Homo sapiens tripartite motif-containing 39 isoform 2 variant protein. Length = 352 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 120 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 178 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 179 RDLAHLAA 186 >AB202089-1|BAE78608.1| 518|Homo sapiens tripartite motif-containing 39 protein. Length = 518 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >AB110938-1|BAD13704.1| 518|Homo sapiens TRIM39 protein protein. Length = 518 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >AB110937-1|BAD13703.1| 518|Homo sapiens TRIM39 protein protein. Length = 518 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 >AB046381-1|BAB16374.1| 518|Homo sapiens testis-abundant finger protein protein. Length = 518 Score = 29.1 bits (62), Expect = 6.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 275 PSRLKTRLVDDRRSRXKEQNXNXATRYRQXKKX*VXVLLKEEQTLRQRHTELGEKCSDLQ 96 P LK RLV+ RR + + R + ++ + L +EEQ + QR E D + Sbjct: 179 PGELK-RLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKR 237 Query: 95 REIRYLKA 72 R++ +L A Sbjct: 238 RDLAHLAA 245 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,990,964 Number of Sequences: 237096 Number of extensions: 485770 Number of successful extensions: 1106 Number of sequences better than 10.0: 71 Number of HSP's better than 10.0 without gapping: 1095 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1106 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3373625546 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -