BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0284.Seq (547 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0259 - 1996427-1998772 27 7.4 >03_01_0259 - 1996427-1998772 Length = 781 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 246 TTVYPNRIYKS*HLSILRGFTLLEMPTKILFNSRQIVCNHC 368 TT PN+ S L+++ G E+ + IL +CNHC Sbjct: 706 TTTMPNK--HSVRLAVVFGLISSEIGSPILVKKNVRICNHC 744 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,745,126 Number of Sequences: 37544 Number of extensions: 196875 Number of successful extensions: 293 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 292 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1222086348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -