BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0272.Seq (499 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22E12.02 |||RNA-binding protein|Schizosaccharomyces pombe|ch... 25 4.8 SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual 25 8.4 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 25 8.4 >SPAC22E12.02 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 219 Score = 25.4 bits (53), Expect = 4.8 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +2 Query: 359 W*TPHFRLNIPNLGNFLGRHIYRYXLSDIPLYTRXRLCR 475 W HFRL + NLGN + S+ P + ++ R Sbjct: 25 WDPNHFRLFVGNLGNDVNDESLYQAFSEYPSLVKTKVVR 63 >SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1828 Score = 24.6 bits (51), Expect = 8.4 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = +1 Query: 220 LNTGRIVVEFQVSGLQAHPSSQGLGLLQSIRATSELQVRGG 342 LN G IVV FQ++ L+ SQ GL S+ + LQ G Sbjct: 207 LNIGTIVVTFQLNVLRCLSLSQINGL--SLNTINNLQSEDG 245 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 24.6 bits (51), Expect = 8.4 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = -3 Query: 353 TNPXPPRTCNSLVARIDCSKPKPCEEGCACKPDT*NSTTIRPV 225 T P PP T + + + P P + G P T + T + PV Sbjct: 906 TLPPPPPTASMTASAPAIASPPPPKVGETYHPPTASGTRVPPV 948 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,941,895 Number of Sequences: 5004 Number of extensions: 36961 Number of successful extensions: 73 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -