BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0272.Seq (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30860.1 68417.m04381 SET domain-containing protein low simil... 30 1.00 At5g08770.1 68418.m01040 expressed protein 29 1.3 At3g46290.1 68416.m05010 protein kinase, putative similar to rec... 28 3.0 At4g15260.1 68417.m02338 UDP-glucoronosyl/UDP-glucosyl transfera... 27 5.3 At2g43255.1 68415.m05376 expressed protein 27 9.3 At2g25660.1 68415.m03075 expressed protein 27 9.3 At1g21240.1 68414.m02654 wall-associated kinase, putative simila... 27 9.3 At1g01650.1 68414.m00083 protease-associated (PA) domain-contain... 27 9.3 >At4g30860.1 68417.m04381 SET domain-containing protein low similarity to IL-5 promoter REII-region-binding protein [Homo sapiens] GI:12642795; contains Pfam profile PF00856: SET domain Length = 497 Score = 29.9 bits (64), Expect = 1.00 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -3 Query: 362 TNCTNPXPPRTCNSLVARIDCSKPKPCEEGCACKP 258 TNC P R+C V I CSK C E C +P Sbjct: 288 TNC-GPNCDRSCVCRVQCISCSKGCSCPESCGNRP 321 >At5g08770.1 68418.m01040 expressed protein Length = 297 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 196 SHLRTFANLNTGRIVVEFQVSGLQAHPSSQG 288 SHLR+F +L+ G + F + ++ PSS G Sbjct: 156 SHLRSFVSLSNGLFKLVFSATTVETSPSSSG 186 >At3g46290.1 68416.m05010 protein kinase, putative similar to receptor-like protein kinase [Catharanthus roseus] gi|1644291|emb|CAA97692 Length = 830 Score = 28.3 bits (60), Expect = 3.0 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 4 LIIICQFNNK*IFLFTYDEFYNILEHFYMRIIS*LTWK-NIE*C 132 LI C NN+ I ++ Y E + H Y + LTWK +E C Sbjct: 544 LIGYCDENNEMILIYEYMENGTVKSHLYGSGLPSLTWKQRLEIC 587 >At4g15260.1 68417.m02338 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 359 Score = 27.5 bits (58), Expect = 5.3 Identities = 11/45 (24%), Positives = 24/45 (53%) Frame = +2 Query: 128 NVFEIHIIINLTLHYNVAQSGELAICGHSQILTQAELSSSFKCLV 262 N FE+ + L + SG+L + G +I+T ++ + +C++ Sbjct: 272 NAFEMVEELGLAVEIRKCISGDLLLIGEMEIVTAEDIERAIRCVM 316 >At2g43255.1 68415.m05376 expressed protein Length = 214 Score = 26.6 bits (56), Expect = 9.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 350 NPXPPRTCNSLVARIDCSKPKPCEEGC 270 NP P R C+ +V ++ K E GC Sbjct: 186 NPDPHRLCDDMVESLNIIKSAALERGC 212 >At2g25660.1 68415.m03075 expressed protein Length = 2146 Score = 26.6 bits (56), Expect = 9.3 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 292 GLLQSIRATSELQVRGGHGFVQLVNSSFS 378 GL+Q LQ R GHG + ++ FS Sbjct: 1201 GLIQKAEIQLNLQKRRGHGLLSVIRPKFS 1229 >At1g21240.1 68414.m02654 wall-associated kinase, putative similar to wall-associated kinase 1 [Arabidopsis thaliana] GI:3549626; expressed in leaves and stems & induced by salicylic acid or INA (PMID:10380805) Length = 741 Score = 26.6 bits (56), Expect = 9.3 Identities = 26/99 (26%), Positives = 37/99 (37%), Gaps = 3/99 (3%) Frame = -3 Query: 461 CVCKEGYLKDXXGKCVARENCPN*-ECSGENEEFTNCTNPXPPRTCNSLVARIDCSKPK- 288 C C EGY G E C + EC + NC++P +TC + DC P Sbjct: 275 CKCNEGY----DGNPYRSEGCKDIDECISDTH---NCSDP---KTCRNRDGGFDCKCPSG 324 Query: 287 -PCEEGCACKPDT*NSTTIRPVLRFANVRKWLALLTVQH 174 +C T I V+ + LA + +QH Sbjct: 325 YDLNSSMSCTRPEYKRTRIFLVIIIGVLVLLLAAICIQH 363 >At1g01650.1 68414.m00083 protease-associated (PA) domain-containing protein contains protease associated (PA) domain, Pfam:PF02225 Length = 491 Score = 26.6 bits (56), Expect = 9.3 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +3 Query: 390 LIWAIFSGDTFTXXVFQISLFTHAXGFAGLLVHRW 494 +I AIF G F Q + G G L+HRW Sbjct: 259 VISAIFGGFLFPDHALQAYVILVYRGVGGTLLHRW 293 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,025,459 Number of Sequences: 28952 Number of extensions: 196251 Number of successful extensions: 410 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 410 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -