BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0270.Seq (498 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_04_0038 - 15339047-15339230,15339683-15339741,15340031-153401... 48 6e-06 07_03_0406 + 17785046-17785408,17786411-17786479,17786764-177868... 46 2e-05 11_06_0767 + 27121761-27123335,27123701-27123910,27124843-271249... 34 0.055 05_01_0538 + 4646772-4647059,4647462-4647542,4647819-4647890,464... 33 0.096 03_06_0223 + 32481444-32482436 31 0.39 08_01_0661 - 5708088-5708131,5708217-5710048,5710527-5710625,571... 31 0.51 09_04_0416 - 17399059-17399777,17400560-17400704 30 0.90 01_01_0884 - 6956337-6956431,6956514-6957651 30 0.90 07_01_0045 - 357463-357921 30 1.2 04_03_0284 + 13896307-13896765 30 1.2 03_06_0695 - 35599454-35600018,35600445-35600491,35600556-35600672 30 1.2 05_05_0120 + 22520285-22520569 29 1.6 11_01_0319 - 2396835-2396951,2397035-2397105,2397219-2397297,239... 29 2.1 10_08_0911 - 21499196-21499236,21499368-21499488,21499665-214997... 29 2.1 06_03_0619 + 22801576-22802016,22802111-22802596 29 2.7 06_01_0193 - 1491710-1491739,1492194-1492319,1492631-1492766,149... 29 2.7 02_05_0101 - 25824093-25824112,25824734-25824842,25824927-258264... 29 2.7 10_08_0674 + 19788198-19789817 28 3.6 02_01_0316 + 2125283-2125687,2125768-2125881,2125986-2126099,212... 28 3.6 08_01_0108 - 791835-792398 28 4.8 03_05_0629 + 26248960-26249236,26249766-26249894,26250291-262508... 28 4.8 02_05_0040 + 25341418-25341810 28 4.8 01_05_0620 + 23742950-23743794,23745705-23746508,23746593-23747793 28 4.8 11_04_0009 - 12132781-12133272 27 6.3 07_01_0733 + 5570084-5570282,5570395-5570600,5572484-5572624,557... 27 6.3 01_03_0117 + 12684729-12685886,12685978-12686145,12686292-126863... 27 6.3 05_07_0041 + 27261968-27262145,27262160-27262717,27262814-27263589 27 8.4 01_05_0789 + 25231013-25231570,25231684-25231761,25232590-252326... 27 8.4 >01_04_0038 - 15339047-15339230,15339683-15339741,15340031-15340160, 15340248-15340498,15340632-15341225,15342050-15342511 Length = 559 Score = 47.6 bits (108), Expect = 6e-06 Identities = 23/53 (43%), Positives = 31/53 (58%) Frame = -2 Query: 434 SVDVLMPGVGEIVGGSXRXWDHEEXMEGYKREGIDPSPXYWYTDQRKFGSVPH 276 ++DVL+P VGE+VGGS R + + G+ P WY D R+FGSV H Sbjct: 472 AMDVLVPKVGELVGGSQREERLDLLKTRIQDAGLPLEPYEWYLDLRRFGSVKH 524 >07_03_0406 + 17785046-17785408,17786411-17786479,17786764-17786868, 17787297-17787346,17787363-17787489,17788084-17788221, 17788863-17788940,17789141-17789218,17789318-17789386, 17789720-17789803,17789895-17789981,17790364-17790459, 17790541-17790615,17790762-17790888,17791027-17791142 Length = 553 Score = 46.0 bits (104), Expect = 2e-05 Identities = 21/54 (38%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Frame = -2 Query: 434 SVDVLMPGVGEIVGGSXRXWDHEEXMEGYKRE-GIDPSPXYWYTDQRKFGSVPH 276 ++D+L+P VGE++GGS R + + +E E ++ +WY D R++GSVPH Sbjct: 466 AMDLLVPRVGELIGGSQRE-ERLDYLEARLDELNLNKDSYWWYLDLRRYGSVPH 518 >11_06_0767 + 27121761-27123335,27123701-27123910,27124843-27124911, 27125387-27125656,27126027-27126377,27126480-27126757, 27126887-27128330 Length = 1398 Score = 34.3 bits (75), Expect = 0.055 Identities = 23/61 (37%), Positives = 29/61 (47%) Frame = +2 Query: 152 SSGRGAQGVHRSRKRG*RHTSRMWYRSRSQQRKRSNPARSRREAPSRTCAGPYTSSXG*G 331 S G + RS R SR W RSRS+ R S +RSR +PSR+ + Y G Sbjct: 1225 SRGYDRRSGSRSLSSRSRSRSRSWSRSRSRSRSWSR-SRSRSRSPSRSRSRSYDQGAGPA 1283 Query: 332 R 334 R Sbjct: 1284 R 1284 >05_01_0538 + 4646772-4647059,4647462-4647542,4647819-4647890, 4648458-4649321 Length = 434 Score = 33.5 bits (73), Expect = 0.096 Identities = 21/59 (35%), Positives = 26/59 (44%) Frame = +2 Query: 110 YTQRHVIRQNKDDTSSGRGAQGVHRSRKRG*RHTSRMWYRSRSQQRKRSNPARSRREAP 286 Y RH + D R +G R R+ RH SR RSRS+ R RS R +P Sbjct: 325 YRSRH--SSERQDDRRDRDREG-SRHRRSSSRHRSRSRSRSRSRSRSRSRSRNEERSSP 380 >03_06_0223 + 32481444-32482436 Length = 330 Score = 31.5 bits (68), Expect = 0.39 Identities = 20/68 (29%), Positives = 34/68 (50%) Frame = +3 Query: 135 KIKTIRRRVEALRACTALGSEGRDTRPGCGTGPGASRGSAQTQPVAAVRHRAELALVRIP 314 K K ++ R+E+L A + PGCG PG+S +T VA +R + ++ Sbjct: 99 KAKVVKLRLESLDRANAANR----SVPGCG--PGSSTDRTRTSVVAGLRKKLRDSMESFS 152 Query: 315 VVRARVDA 338 +RAR+ + Sbjct: 153 SLRARISS 160 >08_01_0661 - 5708088-5708131,5708217-5710048,5710527-5710625, 5711015-5711508,5711579-5711632,5712597-5712683, 5712684-5712776 Length = 900 Score = 31.1 bits (67), Expect = 0.51 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +3 Query: 129 SGKIKTIRRRVEALRACTALGSEGRDTRPGCGTGPGASRGSAQT 260 S +++ I + + L A A G+ G + PG G G G S GS+ + Sbjct: 176 SERLEPISQEIVLLEASDASGAAGGPSVPGTGNGHGQSSGSSDS 219 >09_04_0416 - 17399059-17399777,17400560-17400704 Length = 287 Score = 30.3 bits (65), Expect = 0.90 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 188 RKRG*RHTSRMWYRSRSQQRKRSNPARSRREAPSRTCAGP 307 R+RG + +R+R ++RKR+ PA + P R GP Sbjct: 72 RERGPKEERHPHHRARRKERKRTGPAPAMAMQPPRRKTGP 111 >01_01_0884 - 6956337-6956431,6956514-6957651 Length = 410 Score = 30.3 bits (65), Expect = 0.90 Identities = 22/63 (34%), Positives = 24/63 (38%) Frame = +3 Query: 138 IKTIRRRVEALRACTALGSEGRDTRPGCGTGPGASRGSAQTQPVAAVRHRAELALVRIPV 317 +K RR E LR +A E D P P S A TQP A A PV Sbjct: 238 VKVSRRYGERLRFASASEGEETDLEPDPSPSPSPSPSPAPTQPPTAAAAAAVAPAPPQPV 297 Query: 318 VRA 326 V A Sbjct: 298 VVA 300 >07_01_0045 - 357463-357921 Length = 152 Score = 29.9 bits (64), Expect = 1.2 Identities = 23/63 (36%), Positives = 31/63 (49%) Frame = +2 Query: 116 QRHVIRQNKDDTSSGRGAQGVHRSRKRG*RHTSRMWYRSRSQQRKRSNPARSRREAPSRT 295 +RH R+ + G GA+G G R S RSR++QR+R + R RR RT Sbjct: 46 RRHSWRRRRRPWRRG-GARGRAEVVVAGKRRRSWRRRRSRTRQRRRRSRRRRRRR---RT 101 Query: 296 CAG 304 C G Sbjct: 102 CGG 104 >04_03_0284 + 13896307-13896765 Length = 152 Score = 29.9 bits (64), Expect = 1.2 Identities = 23/63 (36%), Positives = 31/63 (49%) Frame = +2 Query: 116 QRHVIRQNKDDTSSGRGAQGVHRSRKRG*RHTSRMWYRSRSQQRKRSNPARSRREAPSRT 295 +RH R+ + G GA+G G R S RSR++QR+R + R RR RT Sbjct: 46 RRHSWRRRRRPWRRG-GARGRAEVVVAGKRRRSWRRRRSRTRQRRRRSRRRRRRR---RT 101 Query: 296 CAG 304 C G Sbjct: 102 CGG 104 >03_06_0695 - 35599454-35600018,35600445-35600491,35600556-35600672 Length = 242 Score = 29.9 bits (64), Expect = 1.2 Identities = 23/63 (36%), Positives = 31/63 (49%) Frame = +2 Query: 116 QRHVIRQNKDDTSSGRGAQGVHRSRKRG*RHTSRMWYRSRSQQRKRSNPARSRREAPSRT 295 +RH R+ + G GA+G G R S RSR++QR+R + R RR RT Sbjct: 136 RRHSWRRRRRPWRRG-GARGRAEVVVAGKRRRSWRRRRSRTRQRRRRSRRRRRRR---RT 191 Query: 296 CAG 304 C G Sbjct: 192 CGG 194 >05_05_0120 + 22520285-22520569 Length = 94 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +3 Query: 189 GSEGRDTRPGCGTGPGASRGSAQTQPVAAVRHRAELAL 302 G G D R G A+ G Q +P A RHR +++ Sbjct: 35 GGAGEDGRKGAAATADAAGGQQQARPSPAARHRRAMSV 72 >11_01_0319 - 2396835-2396951,2397035-2397105,2397219-2397297, 2397417-2397458,2397670-2397723,2397836-2397868, 2397959-2398039,2398144-2398230,2398313-2398388, 2398633-2398808,2398912-2399034,2399249-2399361, 2399521-2399632,2400054-2400273,2401986-2402314, 2402408-2402713,2403580-2403878,2404079-2404181, 2404266-2404369,2404840-2404906,2404911-2405076, 2405241-2405956 Length = 1157 Score = 29.1 bits (62), Expect = 2.1 Identities = 19/60 (31%), Positives = 27/60 (45%) Frame = +2 Query: 113 TQRHVIRQNKDDTSSGRGAQGVHRSRKRG*RHTSRMWYRSRSQQRKRSNPARSRREAPSR 292 T+RH R ++ S G RSR+ +SR R +S +R R RR +P R Sbjct: 30 TRRHRRRSPSSESCSSSGDDD--RSRRHRHDESSRRRQRDQSHRRDRGGHDERRRRSPQR 87 >10_08_0911 - 21499196-21499236,21499368-21499488,21499665-21499789, 21500187-21500418,21500488-21500668,21501342-21501438, 21501641-21501779,21502024-21502351,21502890-21503137, 21503270-21503543,21504200-21504291,21504451-21504521, 21505091-21505181,21506526-21507380,21507482-21507594, 21508007-21508074,21508655-21508835,21509084-21509186, 21509273-21509379,21510046-21511584,21511661-21511771, 21511856-21511908,21511988-21512063,21512147-21512366, 21512477-21512901,21513193-21513372,21513503-21515474 Length = 2680 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 482 SFKQCRAAWTTAASTESVDVLMPGVGE 402 S + W+ A STESV++L+ VGE Sbjct: 88 SINRTNNVWSEATSTESVEMLLKSVGE 114 >06_03_0619 + 22801576-22802016,22802111-22802596 Length = 308 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +3 Query: 126 LSGKIKTIRRRVEALRA-CTALGSEGRDTRPGCGTGPGASRGSAQTQPVAAVRHRAELAL 302 + G ++ + RR +A++ AL + +R G GPG+S +T VA + + + + Sbjct: 84 MDGDVEQVLRRAKAVKGKLEALDRDNATSRKVPGCGPGSSTDRTRTSVVAGLGKKLKDIM 143 Query: 303 VRIPVVRARVDA 338 +R R+ A Sbjct: 144 DDFQGLRTRMAA 155 >06_01_0193 - 1491710-1491739,1492194-1492319,1492631-1492766, 1493048-1493112,1493213-1493305,1493433-1493498, 1493763-1493843,1493977-1494032,1494692-1494780, 1495340-1495425,1495531-1495647,1496109-1496254, 1496665-1496725,1496831-1496914,1497028-1497135, 1497286-1497388,1497802-1497845,1498100-1498584, 1499417-1499603,1500150-1500362,1501066-1501323 Length = 877 Score = 28.7 bits (61), Expect = 2.7 Identities = 22/63 (34%), Positives = 31/63 (49%) Frame = +2 Query: 116 QRHVIRQNKDDTSSGRGAQGVHRSRKRG*RHTSRMWYRSRSQQRKRSNPARSRREAPSRT 295 +RH R+ + G GA+G G R S RSR++QR+R + R RR +T Sbjct: 304 RRHSWRRRRRPWRRG-GARGRAEVVVAGKRRRSWRRRRSRTRQRRRRSRRRRRRR---KT 359 Query: 296 CAG 304 C G Sbjct: 360 CGG 362 >02_05_0101 - 25824093-25824112,25824734-25824842,25824927-25826429, 25826596-25827333,25827712-25827919,25828455-25830409, 25830868-25830960,25831044-25831100,25831189-25831272, 25831345-25831437,25831622-25832053,25833593-25833933, 25834663-25835215 Length = 2061 Score = 28.7 bits (61), Expect = 2.7 Identities = 23/63 (36%), Positives = 30/63 (47%) Frame = +2 Query: 116 QRHVIRQNKDDTSSGRGAQGVHRSRKRG*RHTSRMWYRSRSQQRKRSNPARSRREAPSRT 295 +RH R + G GA+G G R S RSR++QR+R + R RR RT Sbjct: 95 RRHSWRWRRRPWRRG-GARGRAEVVVAGKRRRSWRRRRSRTRQRRRRSRRRRRRR---RT 150 Query: 296 CAG 304 C G Sbjct: 151 CGG 153 >10_08_0674 + 19788198-19789817 Length = 539 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = -3 Query: 175 ALSASTRRRIVFILPDNMTLCILHSIK 95 A++A+ +R I+F LPD + L +LH ++ Sbjct: 167 AIAAAAQRYILFCLPDLLFLSLLHPLR 193 >02_01_0316 + 2125283-2125687,2125768-2125881,2125986-2126099, 2126271-2126561,2126658-2126768,2127317-2127370, 2127555-2127634,2127912-2128027,2128141-2128382 Length = 508 Score = 28.3 bits (60), Expect = 3.6 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = -2 Query: 440 TESVDVLMPGVGEIVGGSXRXWDHEEXMEGYKREGIDPSPXYWYTDQRKFGSVPH 276 + S DV + G EI+ G+ R E + GID Y D ++G+ PH Sbjct: 420 SNSFDVFVRGE-EIISGAQRVHVPEVLARQAEERGIDVGSIAAYVDAFRYGAPPH 473 >08_01_0108 - 791835-792398 Length = 187 Score = 27.9 bits (59), Expect = 4.8 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = +2 Query: 164 GAQGVHRSRKRG*RHTSRMWYRSRSQQRKRSNPARSRREAPSRTCAG 304 GA+G G R S RSR++QR+R + R RR RTC G Sbjct: 96 GARGRAEVVVAGKRRRSWRRRRSRTRQRRRRSRRRRRRR---RTCGG 139 >03_05_0629 + 26248960-26249236,26249766-26249894,26250291-26250847, 26250933-26251250 Length = 426 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 119 VVYIAFNKAFLLK*FVYLFCWIVFIL 42 V ++AFNK + FV+ FC + IL Sbjct: 314 VAFVAFNKVMTAQYFVWFFCLLPLIL 339 >02_05_0040 + 25341418-25341810 Length = 130 Score = 27.9 bits (59), Expect = 4.8 Identities = 19/48 (39%), Positives = 23/48 (47%) Frame = +2 Query: 164 GAQGVHRSRKRG*RHTSRMWYRSRSQQRKRSNPARSRREAPSRTCAGP 307 G GV R R+ R R +R+ S P R RR AP R C+GP Sbjct: 66 GGAGVPRRRRAAPRR------RCGGSKRRCSGPQR-RRGAPRRRCSGP 106 >01_05_0620 + 23742950-23743794,23745705-23746508,23746593-23747793 Length = 949 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 96 FIECNIHNVMLSGKIKTIRRRVEALRACTALGSE 197 FI+C ++ LS +I T R++ +AC + G + Sbjct: 298 FIKCVLYENNLSSRIITTTRKINVSKACCSSGDD 331 >11_04_0009 - 12132781-12133272 Length = 163 Score = 27.5 bits (58), Expect = 6.3 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 203 RHTSRMWYRSRSQQRKRSNPARSRREAPSRTC-AGPYTSSXG*GR 334 R W R R + S P++ RR R C +G S G GR Sbjct: 106 RRRGEAWRRERRDSKIESRPSQRRRVGGRRGCGSGTCAESAGSGR 150 >07_01_0733 + 5570084-5570282,5570395-5570600,5572484-5572624, 5572773-5572949,5573049-5573145,5573575-5573687, 5573774-5573896,5574004-5574075,5575340-5575432, 5575564-5575674,5575767-5575889,5576834-5576890, 5576939-5577022,5577140-5577214,5577418-5577554, 5577719-5577853,5579029-5579168,5579334-5579399, 5579732-5579838,5579910-5579990,5580064-5580138, 5580224-5580325,5581837-5582005,5582090-5582217, 5582596-5582679,5582779-5582879,5583729-5583882, 5583964-5584038,5584112-5584262,5584463-5585078, 5585427-5585487,5585874-5586019,5586104-5586287, 5586363-5586440,5586603-5586931,5587023-5587199, 5587571-5587667,5587742-5587897,5587962-5588198, 5588271-5588354,5588426-5588486,5588762-5588898 Length = 1912 Score = 27.5 bits (58), Expect = 6.3 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -1 Query: 312 VYGPAQVRLGASRRLRAGFERFLCWLLDRYHIRDVCLYPRFL----ERCTP 172 VY ++RLG + +RA FER C L ++ + L PR + E+C P Sbjct: 1815 VYLDQEIRLGDTEIIRALFERVTCLSLPPKKMK-IYLIPRKIQFVSEKCNP 1864 >01_03_0117 + 12684729-12685886,12685978-12686145,12686292-12686336, 12686438-12687280 Length = 737 Score = 27.5 bits (58), Expect = 6.3 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 467 RAAWTTAASTESVDVLMPGVG 405 RAAW A S ES VL+P G Sbjct: 346 RAAWKAACSAESATVLVPSDG 366 >05_07_0041 + 27261968-27262145,27262160-27262717,27262814-27263589 Length = 503 Score = 27.1 bits (57), Expect = 8.4 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -3 Query: 352 VTSAKASTLARTTGIRTSASSARCLTAATG 263 V ++ TLA TTG+ ASS R + AATG Sbjct: 108 VIASSTRTLATTTGV--IASSTRTIAAATG 135 >01_05_0789 + 25231013-25231570,25231684-25231761,25232590-25232659, 25232743-25232812,25233262-25233469,25233546-25233716 Length = 384 Score = 27.1 bits (57), Expect = 8.4 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 135 KIKTIRRRVEALRACTALGSEGRDTRPGCGTGPG 236 ++ +RR +EALRA G+EG G G GPG Sbjct: 94 QLPELRRLLEALRASRGRGAEGE----GGGGGPG 123 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,746,432 Number of Sequences: 37544 Number of extensions: 198837 Number of successful extensions: 834 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 797 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 826 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -