SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0269.Seq
         (327 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1734.12c |alg12||dolichyl pyrophosphate Man7GlcNAc2 alpha-1,...    28   0.31 
SPBC26H8.04c |||DEP domain|Schizosaccharomyces pombe|chr 2|||Manual    25   3.8  

>SPBC1734.12c |alg12||dolichyl pyrophosphate Man7GlcNAc2
           alpha-1,3-glucosyltransferase Alg12 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 546

 Score = 28.3 bits (60), Expect = 0.31
 Identities = 16/42 (38%), Positives = 27/42 (64%)
 Frame = -3

Query: 130 SRAFFHLLGWLNRPLSMPDIFR*LYKNNIFXLSMRNEHFCSI 5
           S A FHL+ +++RPLS  +IF  +  N+   L ++N ++ SI
Sbjct: 125 SCAQFHLVYYMSRPLS--NIFGLIATNHSLSLLLKNNYYGSI 164


>SPBC26H8.04c |||DEP domain|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1496

 Score = 24.6 bits (51), Expect = 3.8
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +2

Query: 47  IIFIQSSEDVWH 82
           +IFIQ SE++WH
Sbjct: 193 LIFIQMSEEMWH 204


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,130,553
Number of Sequences: 5004
Number of extensions: 17471
Number of successful extensions: 22
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22
length of database: 2,362,478
effective HSP length: 64
effective length of database: 2,042,222
effective search space used: 89857768
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -