BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0269.Seq (327 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1734.12c |alg12||dolichyl pyrophosphate Man7GlcNAc2 alpha-1,... 28 0.31 SPBC26H8.04c |||DEP domain|Schizosaccharomyces pombe|chr 2|||Manual 25 3.8 >SPBC1734.12c |alg12||dolichyl pyrophosphate Man7GlcNAc2 alpha-1,3-glucosyltransferase Alg12 |Schizosaccharomyces pombe|chr 2|||Manual Length = 546 Score = 28.3 bits (60), Expect = 0.31 Identities = 16/42 (38%), Positives = 27/42 (64%) Frame = -3 Query: 130 SRAFFHLLGWLNRPLSMPDIFR*LYKNNIFXLSMRNEHFCSI 5 S A FHL+ +++RPLS +IF + N+ L ++N ++ SI Sbjct: 125 SCAQFHLVYYMSRPLS--NIFGLIATNHSLSLLLKNNYYGSI 164 >SPBC26H8.04c |||DEP domain|Schizosaccharomyces pombe|chr 2|||Manual Length = 1496 Score = 24.6 bits (51), Expect = 3.8 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = +2 Query: 47 IIFIQSSEDVWH 82 +IFIQ SE++WH Sbjct: 193 LIFIQMSEEMWH 204 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,130,553 Number of Sequences: 5004 Number of extensions: 17471 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 89857768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -