BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0265.Seq (399 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g17360.1 68414.m02116 COP1-interacting protein-related simila... 29 1.5 At1g76180.1 68414.m08846 dehydrin (ERD14) identical to SP|P42763... 28 2.6 >At1g17360.1 68414.m02116 COP1-interacting protein-related similar to COP1-Interacting Protein 7 (CIP7) (GI:3327870) [Arabidopsis thaliana] Length = 1032 Score = 28.7 bits (61), Expect = 1.5 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -1 Query: 147 WSAQVQDEWSTTAAAPACLPPQR 79 WS++++ +W TTA +P +P R Sbjct: 934 WSSRMRKKWGTTAQSPVIVPNSR 956 >At1g76180.1 68414.m08846 dehydrin (ERD14) identical to SP|P42763 Dehydrin ERD14 {Arabidopsis thaliana} Length = 185 Score = 27.9 bits (59), Expect = 2.6 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -1 Query: 129 DEWSTTAAAPACLPPQRPRGVDPLKTGVLHKYSALVP*YYMK 4 ++ S AAAP +PP K G+L K +P Y+ K Sbjct: 133 EDGSAVAAAPVVVPPPVEEAHPVEKKGILEKIKEKLPGYHPK 174 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,678,571 Number of Sequences: 28952 Number of extensions: 96833 Number of successful extensions: 219 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 219 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 575830496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -