BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0264.Seq (399 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharom... 30 0.12 SPAC11D3.14c |||oxoprolinase |Schizosaccharomyces pombe|chr 1|||... 25 5.7 SPCC584.01c |||sulfite reductase NADPH flavoprotein subunit |Sch... 25 5.7 SPAC25H1.02 |jmj1||Jmj1 protein|Schizosaccharomyces pombe|chr 1|... 24 10.0 >SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharomyces pombe|chr 2|||Manual Length = 1016 Score = 30.3 bits (65), Expect = 0.12 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = -1 Query: 159 HKCCYHQMYWILRCLSLNQCYWNCRWMIHFHHDCWNCIHKCCYRQMFWIXRCL 1 HK HQ Y I+RC + N M DC HK CY ++ + +C+ Sbjct: 406 HKFLQHQFYQIMRCALCGEFLKNAAGMQCI--DCHYTCHKKCYPKV--VTKCI 454 >SPAC11D3.14c |||oxoprolinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1260 Score = 24.6 bits (51), Expect = 5.7 Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 3/63 (4%) Frame = +1 Query: 7 AXDPEHLAVAALMDTVPTVVMEVYHPPAVPVTLVQTQTAQDPVHLVV---AALMDTVPTV 177 A + E+ + D PT+ VY V Q + PVH ++ A ++DT T+ Sbjct: 638 ASETENENTVFIRDNKPTMYTPVYFAEVGKVNCHVYQLSSLPVHSLITGPAVIVDTTQTL 697 Query: 178 VMK 186 +++ Sbjct: 698 LIE 700 >SPCC584.01c |||sulfite reductase NADPH flavoprotein subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 1006 Score = 24.6 bits (51), Expect = 5.7 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 100 TLVQTQTAQDPVHLVVAALMDTVPTVVMKVYHPPAVPVT 216 T+ +Q+ + HL +A+ + V+ VY P A+ T Sbjct: 149 TVFASQSNVEAAHLALASTLAAKAAPVIHVYEPDAIVTT 187 Score = 24.6 bits (51), Expect = 5.7 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 1 QTAXDPEHLAVAALMDTVPTVVMEVYHPPAVPVT 102 Q+ + HLA+A+ + V+ VY P A+ T Sbjct: 154 QSNVEAAHLALASTLAAKAAPVIHVYEPDAIVTT 187 >SPAC25H1.02 |jmj1||Jmj1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 464 Score = 23.8 bits (49), Expect = 10.0 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 4 TAXDPEHLAVAALMDTVP-TVVMEVYHPPAVPVTLVQTQTAQ 126 TA + + L +D+ P V +E Y P VPV + TAQ Sbjct: 6 TAHEFDDLPKIEFIDSCPYQVFLEQYLKPCVPVLIGPKLTAQ 47 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,124,353 Number of Sequences: 5004 Number of extensions: 19849 Number of successful extensions: 58 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 134126124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -