BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0264.Seq (399 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 27 0.060 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 27 0.060 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 3.9 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 20 9.1 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 20 9.1 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 20 9.1 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 27.5 bits (58), Expect = 0.060 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -1 Query: 174 CWNCIHKCCYHQMYWILRCLS-LNQCYW 94 C NCIH + ++W+ C S +N C + Sbjct: 35 CRNCIHPTVFSVLFWLGYCNSAINPCIY 62 Score = 27.1 bits (57), Expect = 0.079 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -1 Query: 60 CWNCIHKCCYRQMFWIXRC 4 C NCIH + +FW+ C Sbjct: 35 CRNCIHPTVFSVLFWLGYC 53 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 27.5 bits (58), Expect = 0.060 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -1 Query: 174 CWNCIHKCCYHQMYWILRCLS-LNQCYW 94 C NCIH + ++W+ C S +N C + Sbjct: 483 CRNCIHPTVFSVLFWLGYCNSAINPCIY 510 Score = 27.1 bits (57), Expect = 0.079 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -1 Query: 60 CWNCIHKCCYRQMFWIXRC 4 C NCIH + +FW+ C Sbjct: 483 CRNCIHPTVFSVLFWLGYC 501 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 3.9 Identities = 11/38 (28%), Positives = 13/38 (34%) Frame = -1 Query: 204 CRWMIHFHHDCWNCIHKCCYHQMYWILRCLSLNQCYWN 91 CR+ H C C C +M C N WN Sbjct: 737 CRYEAHCFALCHCCDFDACDCEMTCPAGCKCYNDRTWN 774 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 20.2 bits (40), Expect = 9.1 Identities = 5/9 (55%), Positives = 8/9 (88%) Frame = -1 Query: 150 CYHQMYWIL 124 C++ MYWI+ Sbjct: 418 CFNLMYWII 426 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 20.2 bits (40), Expect = 9.1 Identities = 5/9 (55%), Positives = 8/9 (88%) Frame = -1 Query: 150 CYHQMYWIL 124 C++ MYWI+ Sbjct: 418 CFNLMYWII 426 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 20.2 bits (40), Expect = 9.1 Identities = 5/9 (55%), Positives = 8/9 (88%) Frame = -1 Query: 150 CYHQMYWIL 124 C++ MYWI+ Sbjct: 356 CFNLMYWII 364 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,883 Number of Sequences: 438 Number of extensions: 1311 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9885360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -