BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0263.Seq (359 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18511| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_36214| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 >SB_18511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 27.1 bits (57), Expect = 4.6 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 6 IYFIKGTHLR*IFKPTQIIQGQCFNLLTHLYFFNNNFNWL 125 +YFI +R +FK T QG+ + TH FF N L Sbjct: 134 LYFILRNQVRGVFKQTYAFQGEPPPIQTHDDFFRAQQNSL 173 >SB_36214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 27.1 bits (57), Expect = 4.6 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 63 QGQCFNLLTHLYFFNNNFNWLQA 131 QGQ +LLT Y+ NN +L+A Sbjct: 175 QGQAMSLLTRAYYHTNNSVYLEA 197 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,430,316 Number of Sequences: 59808 Number of extensions: 102356 Number of successful extensions: 93 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 572951758 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -