BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0263.Seq (359 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z74042-5|CAA98530.1| 200|Caenorhabditis elegans Hypothetical pr... 27 3.9 Z81483-1|CAB03963.1| 307|Caenorhabditis elegans Hypothetical pr... 26 9.1 >Z74042-5|CAA98530.1| 200|Caenorhabditis elegans Hypothetical protein T11F9.6 protein. Length = 200 Score = 27.1 bits (57), Expect = 3.9 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +3 Query: 75 FNLLTHLYFFNNNFNWL--QA*LGLRE*FSNQTCL 173 FN H YF+ NF++ ++ L E SN TC+ Sbjct: 55 FNNTVHYYFYEENFDFTVKESILRAMELISNHTCI 89 >Z81483-1|CAB03963.1| 307|Caenorhabditis elegans Hypothetical protein C43D7.2 protein. Length = 307 Score = 25.8 bits (54), Expect = 9.1 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 6 IYFIKGTHLR*IFKPTQIIQGQCFNLLTHLYFFNNNFNWLQA 131 IY G + + + + G FNLL L FF+ NF Q+ Sbjct: 257 IYRFDGERAIVVQEDRRTLGGDFFNLLFSLNFFSENFRKFQS 298 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,822,507 Number of Sequences: 27780 Number of extensions: 89702 Number of successful extensions: 114 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 492763868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -