BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0263.Seq (359 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g03290.1 68414.m00307 expressed protein ESTs gb|H36966, gb|R6... 26 8.7 >At1g03290.1 68414.m00307 expressed protein ESTs gb|H36966, gb|R65511, gb|T42324 and gb|T20569 come from this gene Length = 571 Score = 25.8 bits (54), Expect = 8.7 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +1 Query: 121 GFKPSWDYASNLVTKLV*TEKNDSLSQSKR 210 GF +W+ A N V+KLV + D+++ +++ Sbjct: 212 GFDITWNQAENAVSKLVDSTPGDTMTTTQQ 241 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,448,359 Number of Sequences: 28952 Number of extensions: 80916 Number of successful extensions: 112 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 469342752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -