BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0262.Seq (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 28 0.062 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 2.3 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 2.3 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 2.3 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 4.1 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 9.4 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 9.4 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 9.4 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 27.9 bits (59), Expect = 0.062 Identities = 25/93 (26%), Positives = 39/93 (41%) Frame = -2 Query: 414 PPQCPYLVEIDCRRCKGTNLQTWKEGSHSLTNWCNAEGFTWSCPSKIRNWQKDLRIMKAM 235 PPQCP ++D G T K + ++ +A S P +D+ ++K + Sbjct: 565 PPQCPRFRKLDSPSDSGIESGTEKPDKPASSSASSAPTSVCSSPRSEDKEVEDMPVLKRV 624 Query: 234 GLAPDLPEDLYYLIKKAVAMRKHLERNRKDKDS 136 AP L D L+ +A K R + KDS Sbjct: 625 LQAPPL-YDTNSLMDEAYKPHKKF-RALRQKDS 655 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 2.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 351 FVNLFLYIVGSQFQPGR 401 FVN FL+++ +Q GR Sbjct: 16 FVNSFLFVIAAQDSSGR 32 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 2.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 351 FVNLFLYIVGSQFQPGR 401 FVN FL+++ +Q GR Sbjct: 16 FVNSFLFVIAAQDSSGR 32 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 2.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 351 FVNLFLYIVGSQFQPGR 401 FVN FL+++ +Q GR Sbjct: 16 FVNSFLFVIAAQDSSGR 32 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.8 bits (44), Expect = 4.1 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +2 Query: 239 AFMIRRSFCQLRILLGQLHVNPSALH 316 AF+++ +L+I L + +NP H Sbjct: 598 AFLVKNIIPKLQIALSEFVINPHQQH 623 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 20.6 bits (41), Expect = 9.4 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -2 Query: 207 LYYLIKKAVAMRKHLERNRKD 145 LYY + K + R LER D Sbjct: 260 LYYFLHKQLMTRYFLERMSND 280 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 20.6 bits (41), Expect = 9.4 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -2 Query: 207 LYYLIKKAVAMRKHLERNRKD 145 LYY + K + R LER D Sbjct: 260 LYYFLHKQLMTRYFLERMSND 280 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 20.6 bits (41), Expect = 9.4 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 162 ERNRKDKDSKFRLILVESRIHRLARYYKTKSV 67 +R RK+ DSK + ++ H L ++K V Sbjct: 492 QRLRKELDSKTGGVNLKGHAHWLTLHFKDPKV 523 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,306 Number of Sequences: 438 Number of extensions: 2290 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -