BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0261.Seq (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15577| Best HMM Match : Ribosomal_L28e (HMM E-Value=0.00022) 47 1e-05 SB_5153| Best HMM Match : zf-AD (HMM E-Value=2.2) 42 4e-04 SB_650| Best HMM Match : rve (HMM E-Value=0.00048) 28 3.7 SB_46456| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_46512| Best HMM Match : TIL (HMM E-Value=1.3) 27 6.5 SB_40091| Best HMM Match : CNH (HMM E-Value=8.5e-07) 27 6.5 SB_184| Best HMM Match : PAN (HMM E-Value=4.1e-09) 27 6.5 SB_45094| Best HMM Match : DUF1090 (HMM E-Value=1.6) 27 8.6 SB_11192| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_15577| Best HMM Match : Ribosomal_L28e (HMM E-Value=0.00022) Length = 90 Score = 46.8 bits (106), Expect = 1e-05 Identities = 25/69 (36%), Positives = 37/69 (53%) Frame = +3 Query: 246 P*QKGFTVVYKKAKATRKPAKNLIRRPFKAGARRSLYKVKRLLKAXHXRTDLCKAXLRRA 425 P KG + +K KA KP K + + +RR+L ++ + + R DL +RRA Sbjct: 8 PSGKGVVITTRKNKAANKPGKIMNKITISRDSRRTLKTIEGVCDKNYYRMDLKDPAMRRA 67 Query: 426 SAILRSQRP 452 AILRSQ+P Sbjct: 68 CAILRSQKP 76 >SB_5153| Best HMM Match : zf-AD (HMM E-Value=2.2) Length = 132 Score = 41.5 bits (93), Expect = 4e-04 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 1/76 (1%) Frame = +3 Query: 24 RTHCEHVVFGVEIGLN-RKNVVVTELDDHPQQQCIPCEEAQYQKAVQQGAEQCD*PPLLQ 200 R +C +F E + R NV D +P+ C PCE + Y+ +Q+G EQ PP+L+ Sbjct: 38 RKYCNKGLFKGEFQEHWRVNVTEENEDVYPELLCRPCEGSLYR--LQKGKEQ---PPILR 92 Query: 201 VQRLDSQESCWCRGEP 248 ++E C+C +P Sbjct: 93 SWTPHTEEGCFCEAKP 108 >SB_650| Best HMM Match : rve (HMM E-Value=0.00048) Length = 363 Score = 28.3 bits (60), Expect = 3.7 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +3 Query: 42 VVFGVEIGLNRKNVVVTELDDH--PQQQCIPCEEAQYQKAVQ 161 V G+E N +N+ +T + P Q +PC +A Y+ VQ Sbjct: 239 VTIGMEKFTNPRNIQLTSTTTYVPPNQVYVPCSQALYKPEVQ 280 >SB_46456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 27.9 bits (59), Expect = 4.9 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 76 LRFKPISTPNTTCSQCVRRQKGC 8 +R+ P S P QCV R KGC Sbjct: 566 MRYAPQSIPQNPSFQCVIRNKGC 588 >SB_46512| Best HMM Match : TIL (HMM E-Value=1.3) Length = 382 Score = 27.5 bits (58), Expect = 6.5 Identities = 30/83 (36%), Positives = 38/83 (45%), Gaps = 5/83 (6%) Frame = +3 Query: 198 QVQRLDSQESCWCRGEP*QKGFTVVYKKAKATRKPAK---NLIRRPFK-AGARRSLYKVK 365 Q Q +SQ + + K YK AKA KPAK L + +K A A+ L K K Sbjct: 253 QKQNTNSQMQSTYKHKANYKLAKAKYKLAKAKYKPAKAKYKLAKAKYKLAKAKYKLAKAK 312 Query: 366 -RLLKAXHXRTDLCKAXLRRASA 431 +L KA H L KA + A A Sbjct: 313 HKLAKAKH---KLAKAKYKLAKA 332 >SB_40091| Best HMM Match : CNH (HMM E-Value=8.5e-07) Length = 653 Score = 27.5 bits (58), Expect = 6.5 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 27 THCEHVVFGVEIGLNRKNVVVTELDDHPQQQCI 125 +HC+H++ G E G+ N + + D +QC+ Sbjct: 261 SHCKHILIGAEEGIYSLN-ISDHVHDMEMEQCL 292 >SB_184| Best HMM Match : PAN (HMM E-Value=4.1e-09) Length = 720 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 290 YQKAR*KLNPPSIQGWCQEVTV 355 YQK LNP S GWC+ V V Sbjct: 451 YQKDPCVLNPCSSHGWCEAVNV 472 >SB_45094| Best HMM Match : DUF1090 (HMM E-Value=1.6) Length = 169 Score = 27.1 bits (57), Expect = 8.6 Identities = 25/58 (43%), Positives = 30/58 (51%), Gaps = 5/58 (8%) Frame = +3 Query: 273 YKKAKATRKPAK---NLIRRPFK-AGARRSLYKVK-RLLKAXHXRTDLCKAXLRRASA 431 YK AKA KPAK L + +K A A+ L K K +L KA H L KA + A A Sbjct: 65 YKLAKAKYKPAKAKYKLAKAKYKLAKAKYKLAKAKHKLAKAKH---KLAKAKYKLAKA 119 >SB_11192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 27.1 bits (57), Expect = 8.6 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -2 Query: 219 VNQAVVPEGVEVSHIVRLLAERL--FDIALLHKECIVVADDHPV 94 VN+ V ++ +++L RL D++L++K CI A DH V Sbjct: 138 VNEVVKKSSKKLYFLIQLKRARLPPSDLSLIYKACIRSAVDHAV 181 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,018,535 Number of Sequences: 59808 Number of extensions: 298011 Number of successful extensions: 728 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 727 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -