BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0261.Seq (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 25 0.58 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 4.1 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 21 5.4 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 7.1 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 7.1 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 21 7.1 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 21 7.1 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 9.4 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 24.6 bits (51), Expect = 0.58 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 109 RNNNAFLVKKRNIKKPFSKEP 171 R N+ L+KKRN PF K P Sbjct: 8 RINSCDLLKKRNENDPFLKRP 28 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.8 bits (44), Expect = 4.1 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 109 RNNNAFLVKKRNIKKPFSK 165 R N+ L+KKRN PF K Sbjct: 129 RINSCDLLKKRNENDPFLK 147 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 21.4 bits (43), Expect = 5.4 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -2 Query: 222 LVNQAVVPEGVEVSHIVRLLAERLFDIALLHKECIV 115 L+N A + V + + L +++FDI LL C++ Sbjct: 88 LINNATINIDVTLQNDEVLDWKKIFDINLLGLTCMI 123 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.0 bits (42), Expect = 7.1 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -2 Query: 480 GLS*PFLL*WASGXXGWLKHD 418 G+ PFL+ W GW++ + Sbjct: 167 GIVQPFLIHWIWTPHGWMRRN 187 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.0 bits (42), Expect = 7.1 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = +1 Query: 76 KMSSSLNWMIIRNNNAFLVKKRNIKKPFSKEPNNVTNLHSFRYNGLIHKKAVGV 237 K+ SSL+ I NNN + N + NN N Y +I+ + + V Sbjct: 313 KIISSLSNKTIHNNNNYKYNYNNNNYNNNNYNNNYNNNCKKLYYNIINIEQIPV 366 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 21.0 bits (42), Expect = 7.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 36 EHVVFGVEIGLNRKNVVVTEL 98 + V G +G N KNV V EL Sbjct: 243 QEAVPGDNVGFNVKNVSVKEL 263 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.0 bits (42), Expect = 7.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 36 EHVVFGVEIGLNRKNVVVTEL 98 + V G +G N KNV V EL Sbjct: 300 QEAVPGDNVGFNVKNVSVKEL 320 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 176 LFGSLLNGFLILRFFTRNALLL 111 L G +NGF + + +RN + L Sbjct: 242 LSGDRINGFTVAQTISRNGVRL 263 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,311 Number of Sequences: 438 Number of extensions: 2448 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -