BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0258.Seq (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 26 0.25 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 23 1.3 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 25.8 bits (54), Expect = 0.25 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -2 Query: 198 FGQICLTPRNPESCCPXFDSL*KIV 124 F Q+C + R+ +SCC DS+ ++ Sbjct: 342 FLQVCRSRRHSDSCCLCLDSMNAVI 366 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 23.4 bits (48), Expect = 1.3 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -1 Query: 298 AFFFQTTVIFTLSTLLSEVCASLSEYVSVSLFTF 197 AF FQ + T +T++S A + + LF+F Sbjct: 120 AFLFQLSFATTSTTIVSGAMAERCNFKAYCLFSF 153 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,276 Number of Sequences: 438 Number of extensions: 1084 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -