BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0256.Seq (538 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 25 1.2 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 4.9 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 4.9 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 23 4.9 AJ000502-1|CAA04136.1| 299|Anopheles gambiae iron regulatory pr... 23 6.5 AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 23 8.6 AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transpor... 23 8.6 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 25.4 bits (53), Expect = 1.2 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 3/59 (5%) Frame = +1 Query: 76 WRSRSFFLCCH*SPSRALALFGRTITFRDSQAICGPLYR---SQRFRHSIPKFRTLLFR 243 +R + LC H S L F +T + S +CG + + SQ++R+ + K FR Sbjct: 685 YRPQILVLCGHPSSRPLLVNFAYLLTKKLSLLVCGHVTKTHVSQKYRNHLQKKAAEWFR 743 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 4.9 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +3 Query: 216 PKIPNFAFSFPSPTTLRKLNHNPDKPI 296 P +P +A +P+P ++N D P+ Sbjct: 5 PALPLYASRYPTPNGYPQINGEVDAPL 31 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.4 bits (48), Expect = 4.9 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +3 Query: 216 PKIPNFAFSFPSPTTLRKLNHNPDKPI 296 P +P +A +P+P ++N D P+ Sbjct: 5 PALPLYASRYPTPNGYPQINGEVDAPL 31 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 23.4 bits (48), Expect = 4.9 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +3 Query: 216 PKIPNFAFSFPSPTTLRKLNHNPDKPI 296 P +P +A +P+P ++N D P+ Sbjct: 5 PALPLYASRYPTPNGYPQINGEVDAPL 31 >AJ000502-1|CAA04136.1| 299|Anopheles gambiae iron regulatory protein protein. Length = 299 Score = 23.0 bits (47), Expect = 6.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 207 AESLGSV*RATYRLGIPESYRP 142 AESLG + + + IPES +P Sbjct: 234 AESLGLTGQELFSIAIPESCKP 255 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 22.6 bits (46), Expect = 8.6 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 172 ICGPLYRSQRFRHSIPKFRTLLFRSPLLQ 258 +C L R +R+RH + L R LLQ Sbjct: 351 VCQLLGRLERYRHGATQLNINLLRHFLLQ 379 >AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transporter protein. Length = 570 Score = 22.6 bits (46), Expect = 8.6 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -1 Query: 307 VDAAIGLSGLWFSFLNVVGEGNEKAKFGILGSNGGIVGI 191 ++ IG+ GL + G GN F G N G +G+ Sbjct: 344 INRGIGIEGLGTMLAGLWGSGNGTNTF---GENVGAIGV 379 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 530,765 Number of Sequences: 2352 Number of extensions: 10731 Number of successful extensions: 19 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49897362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -