BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0254.Seq (449 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF022971-13|AAG23979.1| 325|Caenorhabditis elegans Serpentine r... 28 3.6 Z77133-3|CAB00868.2| 149|Caenorhabditis elegans Hypothetical pr... 27 6.3 >AF022971-13|AAG23979.1| 325|Caenorhabditis elegans Serpentine receptor, class h protein247 protein. Length = 325 Score = 27.9 bits (59), Expect = 3.6 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 11 LGNTITFFFFPVQNRGFLCMLIKVKQR 91 + N ITFF PV G C+L K +R Sbjct: 19 ISNVITFFEIPVCTFGAYCILFKTPER 45 >Z77133-3|CAB00868.2| 149|Caenorhabditis elegans Hypothetical protein K03A11.5 protein. Length = 149 Score = 27.1 bits (57), Expect = 6.3 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -2 Query: 307 CFQESSFRREQTFTQAWSGKICLCFENIFDIPYHLRKNI 191 C Q RE F+ A C+C N D PY + KN+ Sbjct: 15 CNQLKCKNREPDFSNA--NTTCVCHHNPSDYPYDICKNL 51 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,742,684 Number of Sequences: 27780 Number of extensions: 170492 Number of successful extensions: 294 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 288 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 294 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 788595652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -