BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0253.Seq (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39440.1 68415.m04841 expressed protein 32 0.25 At3g04820.1 68416.m00522 expressed protein contains PFam profile... 31 0.43 At5g22090.1 68418.m02572 expressed protein 31 0.57 At5g45200.1 68418.m05548 disease resistance protein (TIR-NBS-LRR... 29 1.3 At1g06190.1 68414.m00651 expressed protein 29 1.3 At5g61330.1 68418.m07696 rRNA processing protein-related contain... 29 1.7 At4g18600.1 68417.m02755 expressed protein 29 1.7 At4g08310.1 68417.m01372 expressed protein glutamic acid-rich pr... 29 2.3 At2g27470.1 68415.m03320 CCAAT-box binding transcription factor ... 29 2.3 At5g56360.1 68418.m07034 calmodulin-binding protein similar to a... 28 3.0 At5g17160.1 68418.m02010 expressed protein 28 3.0 At2g29620.1 68415.m03598 expressed protein 28 3.0 At5g49220.1 68418.m06093 expressed protein 28 4.0 At5g05700.1 68418.m00627 arginine-tRNA-protein transferase 1 / a... 28 4.0 At1g16800.1 68414.m02018 tRNA-splicing endonuclease positive eff... 28 4.0 At1g05490.1 68414.m00559 C protein immunoglobulin-A-binding beta... 28 4.0 At5g54300.1 68418.m06763 expressed protein contains similarity t... 27 5.3 At5g40450.1 68418.m04905 expressed protein 27 5.3 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 27 7.0 At5g55820.1 68418.m06956 expressed protein 27 7.0 At5g35220.1 68418.m04176 peptidase M50 family protein / sterol-r... 27 7.0 At5g23950.1 68418.m02812 C2 domain-containing protein similar to... 27 7.0 At5g17910.1 68418.m02100 expressed protein 27 7.0 At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-asso... 27 7.0 At3g58110.1 68416.m06480 expressed protein 27 7.0 At3g07050.1 68416.m00837 GTP-binding family protein contains Pfa... 27 7.0 At2g34170.1 68415.m04182 expressed protein contains Pfam profile... 27 7.0 At2g22795.1 68415.m02704 expressed protein 27 7.0 At5g55920.1 68418.m06975 nucleolar protein, putative similar to ... 27 9.3 At3g45830.1 68416.m04960 expressed protein 27 9.3 At3g28770.1 68416.m03591 expressed protein 27 9.3 At3g15150.1 68416.m01916 expressed protein 27 9.3 At2g29820.1 68415.m03622 kelch repeat-containing F-box family pr... 27 9.3 At2g16920.1 68415.m01949 ubiquitin-conjugating enzyme family pro... 27 9.3 At1g56340.1 68414.m06476 calreticulin 1 (CRT1) identical to calr... 27 9.3 At1g32750.1 68414.m04038 HAC13 protein (HAC13) identical to HAC1... 27 9.3 At1g19270.1 68414.m02397 ubiquitin interaction motif-containing ... 27 9.3 >At2g39440.1 68415.m04841 expressed protein Length = 773 Score = 31.9 bits (69), Expect = 0.25 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +1 Query: 118 NDQDNQLDSMIKEPESEEAEGLGDAEESPDQSISSAIL 231 +D+++ LDS IKE + E G D +ES D S IL Sbjct: 592 SDEESALDSAIKESKESEPIGFLDTQESRDSSYIDDIL 629 >At3g04820.1 68416.m00522 expressed protein contains PFam profile PF01142: Uncharacterized protein family UPF0024; expression supported by MPSS Length = 747 Score = 31.1 bits (67), Expect = 0.43 Identities = 20/56 (35%), Positives = 29/56 (51%) Frame = +1 Query: 97 TEENSPQNDQDNQLDSMIKEPESEEAEGLGDAEESPDQSISSAILPTDSGVGELKE 264 T+ N P + D LD + P ++ E +G EE D+S+ S P DSG LK+ Sbjct: 625 TDSNKPLAETD--LDRI---PMNKPVEKVGSTEEIEDESMKSDTNPHDSGETNLKD 675 >At5g22090.1 68418.m02572 expressed protein Length = 463 Score = 30.7 bits (66), Expect = 0.57 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +1 Query: 106 NSPQNDQDNQLDSMIK---EPESEEAEGLGDAEESPDQ 210 N P D+++++DS ++ E E EE E + EE+PD+ Sbjct: 282 NEPNYDKEDEIDSEVQWFDEEEEEEEEEEDEEEEAPDE 319 >At5g45200.1 68418.m05548 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1261 Score = 29.5 bits (63), Expect = 1.3 Identities = 19/66 (28%), Positives = 32/66 (48%) Frame = +1 Query: 151 KEPESEEAEGLGDAEESPDQSISSAILPTDSGVGELKEHQAFKMMNQVQWMKI*LKEGLP 330 +E ES EG G+AE S S + ++ V +LKE K N +++ + G+P Sbjct: 190 RESESPRGEGEGEAEPKTTPSDDSLLHGIETRVEQLKEKLELKSENVTRFIGV---VGMP 246 Query: 331 AVMMST 348 + +T Sbjct: 247 GIGKTT 252 >At1g06190.1 68414.m00651 expressed protein Length = 401 Score = 29.5 bits (63), Expect = 1.3 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +1 Query: 88 PADTEENSPQNDQDNQLDSMIKEPESE-EAEGLGDAEESPDQSISSAILPTDSGV 249 PA E+ P+N+ + + + EP+SE + E +E D ++ +L D G+ Sbjct: 281 PAYEHEHEPENESEPGPVTTMLEPDSELKPESSSFYQEEEDDDVTFDVLSQDDGI 335 >At5g61330.1 68418.m07696 rRNA processing protein-related contains weak similarity to rRNA processing protein EBP2 (EBNA1-binding protein homolog) (Swiss-Prot:P36049) [Saccharomyces cerevisiae] Length = 436 Score = 29.1 bits (62), Expect = 1.7 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +1 Query: 43 MNEESAYIGDN-CLSTPADTEENS-PQNDQDNQLDSMIKEPESEEAEGLGDAEESPD 207 ++ ES I D L +D E++ P +D+++DSM + E + GD EE + Sbjct: 13 LDSESEDISDQENLKAESDNEDDQLPDGIEDDEVDSMEDDEGESEEDDEGDTEEDDE 69 >At4g18600.1 68417.m02755 expressed protein Length = 1907 Score = 29.1 bits (62), Expect = 1.7 Identities = 26/85 (30%), Positives = 36/85 (42%), Gaps = 2/85 (2%) Frame = +1 Query: 1 AEDXMDIDETASGAMNEESAYIGDNCLSTPADTEENSPQND--QDNQLDSMIKEPESEEA 174 +E DID + Y GD +ST + NS ND +D + M +P E + Sbjct: 372 SESESDIDGVPKPKLEH---YFGD--ISTYCSEDANSDNNDGSEDITYEEMAHDPRHENS 426 Query: 175 EGLGDAEESPDQSISSAILPTDSGV 249 E D+S S + LP DS V Sbjct: 427 E---------DESCSGSYLPEDSNV 442 >At4g08310.1 68417.m01372 expressed protein glutamic acid-rich protein precursor - Plasmodium falciparum, PIR2:A54514 Length = 504 Score = 28.7 bits (61), Expect = 2.3 Identities = 17/57 (29%), Positives = 32/57 (56%) Frame = +1 Query: 94 DTEENSPQNDQDNQLDSMIKEPESEEAEGLGDAEESPDQSISSAILPTDSGVGELKE 264 D+E++ + D+D ++ +++E E EE E G +E+ + S + L T+ G E E Sbjct: 452 DSEDSENEEDEDEEV--VVEEEEEEEDE--GGSEDGGEGSQNEGELKTEDGGEEESE 504 >At2g27470.1 68415.m03320 CCAAT-box binding transcription factor subunit HAP3-related contains Pfam PF00808 : Histone-like transcription factor (CBF/NF-Y) and archaeal histone; similar to polymerase epsilon p17 subunit (DNA polymerase epsilon subunit 3) (YB-like protein 1) (YBL1) (NF-YB-like protein) (SP:Q9JKP7) [Mus musculus]; Length = 275 Score = 28.7 bits (61), Expect = 2.3 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 2/85 (2%) Frame = +1 Query: 22 DETASGAMNEESAYIGDNCLSTPADTEENSPQNDQDNQLDSMIKEPESEEA--EGLGDAE 195 DE +EE +N D EEN +N ++N D ++ + E + E ++E Sbjct: 176 DEEDENGNDEEDENDDENTEENGND-EENDDENTEENGNDEENEKEDEENSMEENGNESE 234 Query: 196 ESPDQSISSAILPTDSGVGELKEHQ 270 ES ++ S + SGVGE E++ Sbjct: 235 ESGNEDHS--MEENGSGVGEDNENE 257 >At5g56360.1 68418.m07034 calmodulin-binding protein similar to alpha glucosidase II beta subunit from GI:2104691 [Mus musculus] Length = 647 Score = 28.3 bits (60), Expect = 3.0 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 5/63 (7%) Frame = +1 Query: 94 DTEENSPQNDQDNQLDSMIKEPESEEAE-----GLGDAEESPDQSISSAILPTDSGVGEL 258 D +E + ++ +L +E E +EAE G GDAEE D S D G + Sbjct: 195 DRKEQIEKVEEKERLQKEKEEKEKKEAELAAQQGKGDAEEKTDDSEKVEESSHDEGTPAV 254 Query: 259 KEH 267 +H Sbjct: 255 SQH 257 >At5g17160.1 68418.m02010 expressed protein Length = 569 Score = 28.3 bits (60), Expect = 3.0 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 2/74 (2%) Frame = +1 Query: 64 IGDNCLSTPADTEENSPQNDQDNQL--DSMIKEPESEEAEGLGDAEESPDQSISSAILPT 237 + D L A TE ++ N+ N L D + + E+E A DAE P+ ++ T Sbjct: 304 VSDIPLLESAITETHNDDNESKNVLAIDRSVDQQETEHAIQENDAE--PETKVNQ----T 357 Query: 238 DSGVGELKEHQAFK 279 DS G+ K QA + Sbjct: 358 DSDAGDSKTKQAIQ 371 >At2g29620.1 68415.m03598 expressed protein Length = 747 Score = 28.3 bits (60), Expect = 3.0 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +1 Query: 115 QNDQDNQLDSMIKEPESEEAEGLGDAEESPDQSISSAILPTDSGVGELKEHQA 273 ++DQD + + PE+EEA L E + QS SA D + EL E+ A Sbjct: 549 KDDQDQNETTSLASPENEEARNL---EPTVPQS-DSAFFKRDEELKELSENSA 597 >At5g49220.1 68418.m06093 expressed protein Length = 409 Score = 27.9 bits (59), Expect = 4.0 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 154 EPESEEAEGLGDAEESPDQSISSAILPTDSGVGEL 258 +P + +GD E S + S +S LP D VGEL Sbjct: 194 DPLKKPRNPVGDNEGSSEGSSNSRTLPVDLSVGEL 228 >At5g05700.1 68418.m00627 arginine-tRNA-protein transferase 1 / arginyltransferase 1 / arginyl-tRNA-protein transferase 1 (ATE1) identical to SP|Q9ZT48 Arginine-tRNA-protein transferase 1 (EC 2.3.2.8) (R-transferase 1) (Arginyltransferase 1) (Arginyl-tRNA--protein transferase 1) {Arabidopsis thaliana} Length = 632 Score = 27.9 bits (59), Expect = 4.0 Identities = 17/71 (23%), Positives = 32/71 (45%) Frame = +1 Query: 19 IDETASGAMNEESAYIGDNCLSTPADTEENSPQNDQDNQLDSMIKEPESEEAEGLGDAEE 198 ++ AS + E DN + + E+ +D D+ D + E ESE++ D Sbjct: 515 VEPAASEHEDMEQGETNDNFMGCSDEDEDEDEDDDDDDDDDEEMYETESEDSHIESD-PG 573 Query: 199 SPDQSISSAIL 231 S D I++ ++ Sbjct: 574 SKDNDINNILI 584 >At1g16800.1 68414.m02018 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 1939 Score = 27.9 bits (59), Expect = 4.0 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +1 Query: 124 QDNQLDSMIKEPESEEAEGLGDAEESPDQSISSAILP 234 QDN +D + E E E + L +S I+ +LP Sbjct: 656 QDNMMDLTVDETEKESLKNLPSLHKSHQPDINKTLLP 692 >At1g05490.1 68414.m00559 C protein immunoglobulin-A-binding beta antigen-related contains weak similarity to C protein immunoglobulin-A-binding beta antigen [Streptococcus agalactiae] gi|18028989|gb|AAL56250 Length = 731 Score = 27.9 bits (59), Expect = 4.0 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = +3 Query: 270 SVQDDESSTMDEDIAEGGVAXSDDVNDISSAAQEILSTGXSSSXAEPGSDISSS 431 S+ D E S+ + D E S+D N + E LS+ SS + S SSS Sbjct: 243 SISDGEDSSSETDEEEEENQDSEDNNTKDNVTVESLSSEDPSSSSSSSSSSSSS 296 >At5g54300.1 68418.m06763 expressed protein contains similarity to cotton fiber expressed protein 1 [Gossypium hirsutum] gi|3264828|gb|AAC33276 Length = 326 Score = 27.5 bits (58), Expect = 5.3 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 2/86 (2%) Frame = +1 Query: 136 LDSMIKEPESEEAEGLGDAEESPDQSISSAILPTDSGVGELKEHQAFK--MMNQVQWMKI 309 ++++ K PE +EAE ++ +SP+ L DS + +H K NQ + +K Sbjct: 137 VEAIRKFPEVQEAEKSKESSDSPEPETEKPKLKNDSPEISILKHSTRKPPRFNQQKSLKS 196 Query: 310 *LKEGLPAVMMSTTLVVPHRRYSALE 387 + G + T P RR LE Sbjct: 197 NSEGGNKKTALGVT--KPPRRQDTLE 220 >At5g40450.1 68418.m04905 expressed protein Length = 2910 Score = 27.5 bits (58), Expect = 5.3 Identities = 19/51 (37%), Positives = 25/51 (49%) Frame = +1 Query: 79 LSTPADTEENSPQNDQDNQLDSMIKEPESEEAEGLGDAEESPDQSISSAIL 231 L T +TE ND + SMIKEP +E + D ES ++ S IL Sbjct: 2220 LQTTLETERAI--NDSASSEVSMIKEPADQEEKKGDDVVESNEKDFVSDIL 2268 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 27.1 bits (57), Expect = 7.0 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +3 Query: 306 DIAEGGVAXSDDVNDISSAAQEILSTGXSSSXAEPGSDISSSG 434 +I G A + + SS++ S+G SSS ++ GS SSSG Sbjct: 528 EIERDGTAVAAAASSGSSSSGSSSSSGGSSSSSDSGSGGSSSG 570 >At5g55820.1 68418.m06956 expressed protein Length = 1826 Score = 27.1 bits (57), Expect = 7.0 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = +1 Query: 91 ADTEENSPQ-NDQDNQLDSMIKEPESEEAEGLGDAEESPDQ---SISSAILPTD 240 A+ EN + +D N+ +E S E + LGD E P + S+S A +P D Sbjct: 1353 AEENENIDEISDAVNEASGSERENVSAERKPLGDVNEDPMKLLPSVSEAKIPAD 1406 >At5g35220.1 68418.m04176 peptidase M50 family protein / sterol-regulatory element binding protein (SREBP) site 2 protease family protein contains PFam PF02163: sterol-regulatory element binding protein (SREBP) site 2 protease Length = 548 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/55 (27%), Positives = 24/55 (43%) Frame = +3 Query: 264 APSVQDDESSTMDEDIAEGGVAXSDDVNDISSAAQEILSTGXSSSXAEPGSDISS 428 A + +DE+S D+ I E G V ++ +E T SSS ++ S Sbjct: 53 AKCLGNDENSNRDDSIGENGETHKSSVVKTATFEEEDEETSKSSSTTSSSNEFGS 107 >At5g23950.1 68418.m02812 C2 domain-containing protein similar to cold-regulated gene SRC2 [Glycine max] GI:2055230; contains Pfam profile PF00168: C2 domain Length = 219 Score = 27.1 bits (57), Expect = 7.0 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 258 EGAPSVQDDESSTMDEDIAEGGVAXSDDVND 350 EG +V+ DE D+D A A DD +D Sbjct: 181 EGLEAVEGDEDDDDDDDAAAAAAADDDDDDD 211 >At5g17910.1 68418.m02100 expressed protein Length = 1342 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/58 (25%), Positives = 29/58 (50%) Frame = +1 Query: 70 DNCLSTPADTEENSPQNDQDNQLDSMIKEPESEEAEGLGDAEESPDQSISSAILPTDS 243 D + + D+E + + D +N+ + +E E EE + + +E D SAI T++ Sbjct: 305 DEGMESDGDSESHGEEGDNENEDEEEDEEEEDEEEKQ--EKKEDKDDESKSAIKWTEA 360 >At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-associated herpes-like virus ORF73gene, Kaposi's sarcoma-associated herpesvirus, U52064 Length = 532 Score = 27.1 bits (57), Expect = 7.0 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 2/92 (2%) Frame = +1 Query: 4 EDXMDIDETASGAMNEESAYIGDNCLSTPADTEENSPQNDQDNQLDSMIKEPESEEAEGL 183 +D D E G+ NE G +ST +EN + + + + ++E +EAEG Sbjct: 77 KDVKDEVEDEEGSKNE-----GGGDVSTD---KENGDEIVEREEEEKAVEENNEKEAEGT 128 Query: 184 GDAE--ESPDQSISSAILPTDSGVGELKEHQA 273 G+ E E + S ++ G E+ +A Sbjct: 129 GNEEGNEDSNNGESEKVVDESEGGNEISNEEA 160 >At3g58110.1 68416.m06480 expressed protein Length = 784 Score = 27.1 bits (57), Expect = 7.0 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +1 Query: 91 ADTEENSPQNDQD-NQLDSMIKEPESEEAEGLGDAEESPDQSISSAILPTDSGVGELKE 264 AD EE+ +D D ++D ++K P+ D E ++ + +A D G +LKE Sbjct: 314 ADDEEDDDDDDDDVKEVDFLVKSPKE-------DCLEVKEEDVGAADSRKDDGAVDLKE 365 >At3g07050.1 68416.m00837 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 582 Score = 27.1 bits (57), Expect = 7.0 Identities = 28/100 (28%), Positives = 43/100 (43%), Gaps = 9/100 (9%) Frame = +1 Query: 16 DIDETASGAMNEESAYIGDNCLST-----PADTEENSPQNDQDNQLDSMIKEPESEEAEG 180 +IDE SG ES++IG L T P N P N + ++ K EEAE Sbjct: 428 NIDEVYSG----ESSFIGS--LKTVNEFNPVIIPSNGPLNFDETMIEDESKTQTEEEAEH 481 Query: 181 LGDAEES----PDQSISSAILPTDSGVGELKEHQAFKMMN 288 D +ES ++ +++G +K + A M+N Sbjct: 482 ESDDDESMGGEEEEEAGKTKEKSETGRQNVKLYAAESMLN 521 >At2g34170.1 68415.m04182 expressed protein contains Pfam profile: PF05097 protein of unknown function (DUF688) Length = 523 Score = 27.1 bits (57), Expect = 7.0 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +1 Query: 103 ENSPQNDQDNQLDSMIKEPE--SEEAEGLGDAEESPDQSISSAILPTDSGVGELKEHQAF 276 ENSP+ +N+ ++ K PE SEE E G ++ + + L SGV +K + Sbjct: 375 ENSPRTSNENRSSNVKKLPETISEEPEMEGKKPKAVRELKAVETLSISSGVKMMKADELG 434 Query: 277 K 279 K Sbjct: 435 K 435 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 27.1 bits (57), Expect = 7.0 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 97 TEENSPQNDQDNQLDSMIKEPESEEAEGLGDAEESPDQSI 216 TEE+ + +DN + E +E G+ ++EES ++ I Sbjct: 249 TEESEVEEKKDNGSSEESEVEEKKENRGIDESEESKEKDI 288 >At5g55920.1 68418.m06975 nucleolar protein, putative similar to SP|P46087 Proliferating-cell nucleolar antigen p120 (Proliferation-associated nucleolar protein p120) {Homo sapiens}, SP|P40991 Nucleolar protein NOP2 {Saccharomyces cerevisiae}; contains Pfam profile PF01189: NOL1/NOP2/sun family Length = 682 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/79 (20%), Positives = 32/79 (40%) Frame = +1 Query: 7 DXMDIDETASGAMNEESAYIGDNCLSTPADTEENSPQNDQDNQLDSMIKEPESEEAEGLG 186 D D D+ + +EE D + ++ +ND++ D ++ E+ EG Sbjct: 80 DGSDEDDISPAVESEEIDESDDGENGSNQLFSDDEEENDEETLGDDFLEGSGDEDEEGSL 139 Query: 187 DAEESPDQSISSAILPTDS 243 DA+ D + +D+ Sbjct: 140 DADSDADSDDDDIVAKSDA 158 >At3g45830.1 68416.m04960 expressed protein Length = 1298 Score = 26.6 bits (56), Expect = 9.3 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = +1 Query: 4 EDXMDIDETASGAMNEESAYIGDNCLSTPADTEEN-SPQNDQDNQLDSMIKEPESEEAEG 180 ED +D+ ++ A+ G+N S P + E+N SPQ N I+E S Sbjct: 838 EDSLDVSKSV--AVENAEHETGENGASVPEEAEDNKSPQQGNGNLPSLTIQEIVSCVKSN 895 Query: 181 LGD 189 GD Sbjct: 896 PGD 898 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 26.6 bits (56), Expect = 9.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 40 AMNEESAYIGDNCLSTPADTEENS 111 +MN ++ GD+ +ST DTE N+ Sbjct: 1860 SMNNQTTGTGDDIISTTTDTESNT 1883 >At3g15150.1 68416.m01916 expressed protein Length = 249 Score = 26.6 bits (56), Expect = 9.3 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = -1 Query: 481 MPGPXXEDDINDGSXWPLLEMSDP--GSAXLELI-PVLSISC 365 MPG ED + + PLL M+ P G EL PV S+ C Sbjct: 137 MPGDDDEDIVMTSTQCPLLNMTCPLSGKPVTELADPVRSMDC 178 >At2g29820.1 68415.m03622 kelch repeat-containing F-box family protein similar to SKP1 interacting partner 6 [Arabidopsis thaliana] GI:10716957; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 388 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +1 Query: 94 DTEENSPQNDQDNQLDSMIKEPESEEAEGLGDAEESPDQSISSAI 228 D N+PQ +DNQ E EE E L + E P++ I I Sbjct: 14 DDPNNNPQEGEDNQ-----NENPQEEVENLRNLLELPEELIERLI 53 >At2g16920.1 68415.m01949 ubiquitin-conjugating enzyme family protein low similarity to ubiquitin-conjugating BIR-domain enzyme APOLLON [Homo sapiens] GI:8489831, ubiquitin-conjugating enzyme [Mus musculus] GI:3319990; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 1102 Score = 26.6 bits (56), Expect = 9.3 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 3/72 (4%) Frame = +1 Query: 34 SGAMNEESAYIGDNCLSTPADTEENSPQNDQDNQLDSM-IKEPE--SEEAEGLGDAEESP 204 +G++ S GD+ + EE +D+DN D ++E + SEE GD E+ Sbjct: 48 TGSVGVVSEVAGDSDSDSDISDEEEDDDDDEDNDDDDEDVEEGKKASEENVVNGDGEKKA 107 Query: 205 DQSISSAILPTD 240 D + L D Sbjct: 108 DGNYKCGALEGD 119 >At1g56340.1 68414.m06476 calreticulin 1 (CRT1) identical to calreticulin (crt1) GI:2052379 [Arabidopsis thaliana] Length = 425 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = +1 Query: 88 PADTEENSPQNDQDNQLDSMIKEPESE---EAEGLGDAEES 201 PA+++ D DN+ D E +SE EAE +AEE+ Sbjct: 378 PAESDAEEEAEDDDNEGDDSDNESKSEETKEAEETKEAEET 418 >At1g32750.1 68414.m04038 HAC13 protein (HAC13) identical to HAC13 [Arabidopsis thaliana] gi|21105767|gb|AAM34782; contains Pfam domains, PF00439: Bromodomain and PF00240: Ubiquitin family Length = 1919 Score = 26.6 bits (56), Expect = 9.3 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +1 Query: 94 DTEENSPQNDQDNQLDSMIKEPES-EEAEGLGDAEES 201 D +EN +N+ ++ LDS + E+ +AE G+ EES Sbjct: 1203 DGDENESENEANSDLDSFAGDLENLLDAEEGGEGEES 1239 >At1g19270.1 68414.m02397 ubiquitin interaction motif-containing protein / LIM domain-containing protein weak similarity to LIM-homeobox protein [Mus musculus] GI:2149584, Hic-5 [Mus musculus] GI:664955; contains Pfam profiles PF02809: Ubiquitin interaction motif, PF00412: LIM domain Length = 532 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +1 Query: 70 DNCLSTPADTEENSPQNDQDNQLDSMIKEPESEEAEGLGDAE-ESPDQSISSAIL 231 DN + D E ++ D DN +EP + E D E E D++I+ ++L Sbjct: 29 DNYPTASHDDEPSAADTDADNDEPHHTQEPSTSEDNTSNDQENEDIDRAIALSLL 83 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,888,188 Number of Sequences: 28952 Number of extensions: 124818 Number of successful extensions: 633 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -