BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0250.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 4.9 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 4.9 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 4.9 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 280 PVKN*SSLNLPRMSFITLFMFVLNTSTWSGAFS 378 PV+ +L+LPR + F N+ T +G +S Sbjct: 197 PVQVVKNLHLPRFTLEKFFTDYCNSKTNTGEYS 229 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 280 PVKN*SSLNLPRMSFITLFMFVLNTSTWSGAFS 378 PV+ +L+LPR + F N+ T +G +S Sbjct: 197 PVQVVKNLHLPRFTLEKFFTDYCNSKTNTGEYS 229 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/37 (29%), Positives = 15/37 (40%) Frame = +3 Query: 213 VFAYHQSLYIPSWQHAITIHRLPSKELKFLKPAEDVF 323 V + S SWQ ++H L K L+ E F Sbjct: 76 VHHFESSFNAQSWQRLTSLHELHVHGCKVLRIPEGAF 112 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,828 Number of Sequences: 438 Number of extensions: 3383 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -