BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0249.Seq (499 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23H3.12c |||conserved protein |Schizosaccharomyces pombe|chr... 25 6.3 SPAP8A3.10 |||mitochondrial intermembrane space protein sorting ... 25 8.4 >SPAC23H3.12c |||conserved protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 226 Score = 25.0 bits (52), Expect = 6.3 Identities = 14/55 (25%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 225 LARPHRRASHVTKCELNAQQTLLATHALWIVGQIVFL---VSFLIITTVTFLLAF 380 + P S ELN + L TH +++G I+ L + F++I + + F Sbjct: 93 IEHPPNLESSTILAELNRSKQLQKTHTNYLIGNIIGLPLTIPFILIPLIPNIPGF 147 >SPAP8A3.10 |||mitochondrial intermembrane space protein sorting protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 171 Score = 24.6 bits (51), Expect = 8.4 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 364 VTVVMMRKLTRNTIWPTIHSAWVAR 290 +T + K N W T+ SAW+ R Sbjct: 1 MTAICTDKTELNASWNTVSSAWLTR 25 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,374,883 Number of Sequences: 5004 Number of extensions: 18477 Number of successful extensions: 41 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -