BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0247.Seq (379 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g07810.1 68418.m00895 SNF2 domain-containing protein / helica... 28 2.4 At2g35350.1 68415.m04334 protein phosphatase 2C family protein /... 28 2.4 >At5g07810.1 68418.m00895 SNF2 domain-containing protein / helicase domain-containing protein / HNH endonuclease domain-containing protein similar to HepA-related protein HARP [Homo sapiens] GI:6693791; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF01844: HNH endonuclease Length = 1190 Score = 27.9 bits (59), Expect = 2.4 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 312 RREQTFTQAWSRKNMPLLR 256 R+E+ +TQAWS N PL + Sbjct: 966 RKEKEYTQAWSMSNEPLCK 984 >At2g35350.1 68415.m04334 protein phosphatase 2C family protein / PP2C family protein similar to protein phosphatase-2c (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain Length = 783 Score = 27.9 bits (59), Expect = 2.4 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 163 NLKHYKXYSKSXLVVLNTXXLTEMVRNIEYVSKQRHIFP 279 +L+HY+ +VL++ L + + N+E VS FP Sbjct: 683 SLRHYRLTENDQFMVLSSDGLYQYLSNVEVVSLAMEKFP 721 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,049,869 Number of Sequences: 28952 Number of extensions: 90245 Number of successful extensions: 126 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 517767328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -