BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0244.Seq (528 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0488 - 3597652-3598761,3599619-3600860 27 7.1 01_06_1086 - 34421837-34422311,34422426-34422612,34423162-344232... 27 9.3 >01_01_0488 - 3597652-3598761,3599619-3600860 Length = 783 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 286 DPIHLGFGALNTYGVNSFSIGLALFSCYVG 375 DP+H G L + VN FS L F+C G Sbjct: 580 DPLHDGKTMLKIWNVNKFSGVLGAFNCQGG 609 >01_06_1086 - 34421837-34422311,34422426-34422612,34423162-34423291, 34423485-34423720,34423804-34423961,34424048-34424128, 34424216-34424281,34424364-34424432,34424722-34424866, 34425645-34426138,34426244-34426811,34429529-34429574 Length = 884 Score = 27.1 bits (57), Expect = 9.3 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 Query: 58 TLPYNSLNSIVL*SYSYRRLVG 123 T+PYN +NS+ + SY +L+G Sbjct: 451 TIPYNQVNSLKSLNLSYNQLIG 472 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,325,488 Number of Sequences: 37544 Number of extensions: 209712 Number of successful extensions: 224 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 224 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1166441080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -