BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0243.Seq (548 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0610 + 24335153-24337724,24337835-24338256 30 1.4 02_01_0075 - 522554-522616,522742-522748,523033-523136,523237-52... 29 2.4 01_01_0802 + 6246267-6247541,6247625-6247682,6247806-6248129,624... 29 3.2 06_01_0444 + 3141018-3141503,3141967-3142066,3142940-3142980 28 5.6 04_01_0492 + 6476586-6476873,6477414-6477686,6477769-6477948,647... 27 7.5 05_07_0133 - 27908427-27908555,27908705-27908827,27908915-279090... 27 9.9 02_04_0458 - 23102262-23102377,23102505-23102661,23103094-231041... 27 9.9 02_02_0436 - 10212611-10212984,10213213-10213642,10213660-10215459 27 9.9 01_06_0390 - 28938485-28938751,28939924-28941282 27 9.9 >02_04_0610 + 24335153-24337724,24337835-24338256 Length = 997 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +3 Query: 120 SLLNLMILKLTSREITSNIPESLSR 194 +L L+ LKLTS ++T NIP +L R Sbjct: 481 NLRQLVYLKLTSNKLTGNIPNALDR 505 >02_01_0075 - 522554-522616,522742-522748,523033-523136,523237-523368, 525209-525401,525978-526330,526693-526791,526864-526935, 527062-527213,527338-527386,527755-527885,528067-528307, 528392-528565,528656-528797,529236-529282,529370-529450, 530170-530271,530345-530440,531437-531444,531575-531616, 531830-531894,534761-534853,534888-534959,535303-535509, 536318-537226,537503-538158 Length = 1429 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 47 VWEDDDDLFPGFSDTFKMPEIPEIKSLEFDD 139 +W+ DDD FP F+ IP+ S +FDD Sbjct: 1072 IWDSDDD-FPNEEKHFRTQIIPKDLSQDFDD 1101 >01_01_0802 + 6246267-6247541,6247625-6247682,6247806-6248129, 6248321-6248355 Length = 563 Score = 28.7 bits (61), Expect = 3.2 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +2 Query: 53 EDDDDLFPGFSDTFKMPEIPEIKSLEFDDIKTHVAGDNEQYTG 181 E + D P +T PE PE S++ + K + A DNE+Y G Sbjct: 413 EVEQDQMPPVQETLHNPE-PE--SIDIEPPKENTADDNERYVG 452 >06_01_0444 + 3141018-3141503,3141967-3142066,3142940-3142980 Length = 208 Score = 27.9 bits (59), Expect = 5.6 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 283 FLRRLFRHLSLANSAAAHCLAVDRG 209 FLR LFR ++NS A A+DRG Sbjct: 114 FLRALFRRDRISNSGAVGLCAMDRG 138 >04_01_0492 + 6476586-6476873,6477414-6477686,6477769-6477948, 6478436-6478696,6479171-6479303,6479404-6479494, 6479921-6480023,6480557-6480660,6480809-6480902, 6480985-6481140,6481224-6481286,6481388-6481453, 6481670-6481870,6481999-6482076,6482165-6482284, 6482382-6482462,6482548-6482633,6482920-6483031, 6483093-6483170,6483306-6483482 Length = 914 Score = 27.5 bits (58), Expect = 7.5 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +2 Query: 47 VWEDDDDLFPGFSDTFKMPEIPEIKSLEFDDIKTHVAGDNEQY 175 VW+DD L G+ + K+ I S + I+ + NE+Y Sbjct: 245 VWQDDTILVIGWGTSVKIAAIRTDSSQGLNGIQRSITASNEKY 287 >05_07_0133 - 27908427-27908555,27908705-27908827,27908915-27909022, 27909109-27909198,27909304-27909363,27909454-27909516, 27909604-27909678,27910337-27910402,27910607-27910786 Length = 297 Score = 27.1 bits (57), Expect = 9.9 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +3 Query: 138 ILKLTSREITSNIPESLSRVTVPHPRSTARQ*AAAELASD 257 ILKLT +E +P+ VTVPH S Q AEL + Sbjct: 149 ILKLT-KETREMLPDITLSVTVPHTLSLLDQVRLAELLEE 187 >02_04_0458 - 23102262-23102377,23102505-23102661,23103094-23104140, 23104357-23104500,23105389-23105457 Length = 510 Score = 27.1 bits (57), Expect = 9.9 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -3 Query: 183 SPVYCSLSPAT*VLISSNSRDFISGISGILNVSENPGN 70 +P +C PA+ V + S+ FIS + ILN + P + Sbjct: 33 NPQFCHTQPASFVTVISDRTTFISIFAKILNSAIQPAS 70 >02_02_0436 - 10212611-10212984,10213213-10213642,10213660-10215459 Length = 867 Score = 27.1 bits (57), Expect = 9.9 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 120 SLLNLMILKLTSREITSNIPESLSRVT 200 +L +L+ L L++ EIT +IPES+ +T Sbjct: 300 NLRSLIKLYLSTNEITGSIPESIGNLT 326 >01_06_0390 - 28938485-28938751,28939924-28941282 Length = 541 Score = 27.1 bits (57), Expect = 9.9 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 5/43 (11%) Frame = +2 Query: 17 TLITIASAGFVWEDDDDLFP-----GFSDTFKMPEIPEIKSLE 130 T+I +A+ W D DD+F G++D +PEIPE S E Sbjct: 192 TIIEMATGRVPWSDMDDVFSAVHRIGYTDA--VPEIPEWLSPE 232 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,590,692 Number of Sequences: 37544 Number of extensions: 194821 Number of successful extensions: 509 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 509 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1233951264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -