BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0243.Seq (548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_19324| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2362 Score = 28.3 bits (60), Expect = 4.4 Identities = 20/57 (35%), Positives = 32/57 (56%) Frame = +3 Query: 60 MTICSRDFQIRSRCQRYQR*SLLNLMILKLTSREITSNIPESLSRVTVPHPRSTARQ 230 MT+C Q+ ++R LLN + +TS E+T+N+ S+ RV V ++TA Q Sbjct: 1119 MTMCDVMNQLMEWRAAHERTLLLNADMSDVTSAEVTANL--SIIRVLVLAIQTTADQ 1173 >SB_19324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 345 IFLFVNNRWIYLIAIFVFHDLFFDGFSVIC 256 + L+ N +Y + FVFHDL+F ++ IC Sbjct: 138 VLLYCNITLVY--SNFVFHDLYFFYYTTIC 165 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,799,954 Number of Sequences: 59808 Number of extensions: 231552 Number of successful extensions: 548 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 547 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -