BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0242.Seq (499 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 23 1.2 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 23 1.2 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 1.5 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 1.5 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 4.7 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 21 4.7 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 6.2 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 465 PRPDLADY*PPGPALPP 415 P P + D PGPALPP Sbjct: 153 PNPSIID---PGPALPP 166 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 465 PRPDLADY*PPGPALPP 415 P P + D PGPALPP Sbjct: 153 PNPSIID---PGPALPP 166 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 23.0 bits (47), Expect = 1.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 153 AVLWLGGAGPLVVIKKTFVHTVSNLVFS 70 A+L GAG ++ HT SNL S Sbjct: 108 AILGSSGAGKTTLLNTLTFHTSSNLTVS 135 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 23.0 bits (47), Expect = 1.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 153 AVLWLGGAGPLVVIKKTFVHTVSNLVFS 70 A+L GAG ++ HT SNL S Sbjct: 108 AILGSSGAGKTTLLNTLTFHTSSNLTVS 135 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 4.7 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +3 Query: 291 SEHWLSEYCLVWEATSRGFSSRFRIPKLLHE 383 +E + EY LVW + R + LHE Sbjct: 187 NEDYSCEYNLVWIKEESIYEERISVVSGLHE 217 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 21.4 bits (43), Expect = 4.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 324 WEATSRGFSSRFRIPKLLHEI 386 W ATSR F++ + P + EI Sbjct: 313 WSATSRVFATFYNKPLIHKEI 333 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 6.2 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = +3 Query: 315 CLVWEATSRGFSSRFRIPKL 374 C VW+ + RFR+ K+ Sbjct: 229 CGVWKRIPHDYRKRFRMEKI 248 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,480 Number of Sequences: 336 Number of extensions: 2635 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -