BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0242.Seq (499 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC026087-1|AAH26087.1| 275|Homo sapiens IBR domain containing 1... 33 0.55 AL136128-2|CAI22999.1| 275|Homo sapiens protein ( gene encodin... 33 0.55 AL136128-1|CAC36346.1| 202|Homo sapiens protein ( Human DNA seq... 33 0.55 AF525398-1|AAO14994.1| 1265|Homo sapiens codanin I protein. 29 6.8 Z25470-1|CAA80962.1| 325|Homo sapiens melanocortin receptor pro... 29 9.0 U08353-1|AAB60376.1| 325|Homo sapiens melanocortin-5 receptor p... 29 9.0 L27080-1|AAA59566.1| 325|Homo sapiens melanocortin 5 receptor p... 29 9.0 BC095531-1|AAH95531.1| 325|Homo sapiens melanocortin 5 receptor... 29 9.0 BC069545-1|AAH69545.1| 325|Homo sapiens melanocortin 5 receptor... 29 9.0 BC069153-1|AAH69153.1| 325|Homo sapiens melanocortin 5 receptor... 29 9.0 AY268429-1|AAP23196.1| 325|Homo sapiens melanocortin 5 receptor... 29 9.0 >BC026087-1|AAH26087.1| 275|Homo sapiens IBR domain containing 1 protein. Length = 275 Score = 33.1 bits (72), Expect = 0.55 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +1 Query: 73 KYKI*YSMYKSFLNNNKRPCPTQPQHSTLRRAGHVCTPSLYSIK-KVRC 216 KYK Y + ++++ +PCP +T ++ GH+ TPS K K++C Sbjct: 37 KYK--YFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQC 83 >AL136128-2|CAI22999.1| 275|Homo sapiens protein ( gene encoding two variants of ).). Length = 275 Score = 33.1 bits (72), Expect = 0.55 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +1 Query: 73 KYKI*YSMYKSFLNNNKRPCPTQPQHSTLRRAGHVCTPSLYSIK-KVRC 216 KYK Y + ++++ +PCP +T ++ GH+ TPS K K++C Sbjct: 37 KYK--YFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQC 83 >AL136128-1|CAC36346.1| 202|Homo sapiens protein ( Human DNA sequence from clone RP1-84N20 on chromosome 6 Contains a novel gene, the 5' end of the TPD52L1 gene encoding two variants of ). Length = 202 Score = 33.1 bits (72), Expect = 0.55 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +1 Query: 73 KYKI*YSMYKSFLNNNKRPCPTQPQHSTLRRAGHVCTPSLYSIK-KVRC 216 KYK Y + ++++ +PCP +T ++ GH+ TPS K K++C Sbjct: 37 KYK--YFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQC 83 >AF525398-1|AAO14994.1| 1265|Homo sapiens codanin I protein. Length = 1265 Score = 29.5 bits (63), Expect = 6.8 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -2 Query: 465 PRPDLADY*PPGPALPPHRMGLGL-KILFHVVIWEYEIARRIRARSPPTQGSTPTA 301 PRP LA P PA P G+ +L ++ E +A +R + TQGS TA Sbjct: 17 PRPSLAARGAPAPAQSPQSAPTGMAAVLESLLREEVSVAAVVRWIARSTQGSEVTA 72 >Z25470-1|CAA80962.1| 325|Homo sapiens melanocortin receptor protein. Length = 325 Score = 29.1 bits (62), Expect = 9.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 406 HAVRGQRRAGRSVVGEVWSWCRGCXVV 486 H + RR+G + G +W++C GC +V Sbjct: 151 HHIMTARRSGAIIAG-IWAFCTGCGIV 176 >U08353-1|AAB60376.1| 325|Homo sapiens melanocortin-5 receptor protein. Length = 325 Score = 29.1 bits (62), Expect = 9.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 406 HAVRGQRRAGRSVVGEVWSWCRGCXVV 486 H + RR+G + G +W++C GC +V Sbjct: 151 HHIMTARRSGAIIAG-IWAFCTGCGIV 176 >L27080-1|AAA59566.1| 325|Homo sapiens melanocortin 5 receptor protein. Length = 325 Score = 29.1 bits (62), Expect = 9.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 406 HAVRGQRRAGRSVVGEVWSWCRGCXVV 486 H + RR+G + G +W++C GC +V Sbjct: 151 HHIMTARRSGAIIAG-IWAFCTGCGIV 176 >BC095531-1|AAH95531.1| 325|Homo sapiens melanocortin 5 receptor protein. Length = 325 Score = 29.1 bits (62), Expect = 9.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 406 HAVRGQRRAGRSVVGEVWSWCRGCXVV 486 H + RR+G + G +W++C GC +V Sbjct: 151 HHIMTARRSGAIIAG-IWAFCTGCGIV 176 >BC069545-1|AAH69545.1| 325|Homo sapiens melanocortin 5 receptor protein. Length = 325 Score = 29.1 bits (62), Expect = 9.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 406 HAVRGQRRAGRSVVGEVWSWCRGCXVV 486 H + RR+G + G +W++C GC +V Sbjct: 151 HHIMTARRSGAIIAG-IWAFCTGCGIV 176 >BC069153-1|AAH69153.1| 325|Homo sapiens melanocortin 5 receptor protein. Length = 325 Score = 29.1 bits (62), Expect = 9.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 406 HAVRGQRRAGRSVVGEVWSWCRGCXVV 486 H + RR+G + G +W++C GC +V Sbjct: 151 HHIMTARRSGAIIAG-IWAFCTGCGIV 176 >AY268429-1|AAP23196.1| 325|Homo sapiens melanocortin 5 receptor protein. Length = 325 Score = 29.1 bits (62), Expect = 9.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 406 HAVRGQRRAGRSVVGEVWSWCRGCXVV 486 H + RR+G + G +W++C GC +V Sbjct: 151 HHIMTARRSGAIIAG-IWAFCTGCGIV 176 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,513,000 Number of Sequences: 237096 Number of extensions: 1724339 Number of successful extensions: 4751 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 4514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4740 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4536472160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -