BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0239.Seq (419 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42436-10|AAF99899.1| 272|Caenorhabditis elegans Ribosomal prot... 79 1e-15 >U42436-10|AAF99899.1| 272|Caenorhabditis elegans Ribosomal protein, small subunitprotein 2 protein. Length = 272 Score = 79.0 bits (186), Expect = 1e-15 Identities = 41/54 (75%), Positives = 44/54 (81%) Frame = +2 Query: 254 IKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRXKAXVAIGDNXGHIGLGV 415 IKEFEIID L +L DEVLKI PVQKQT AGQRTR KA VAIGD+ GH+GLGV Sbjct: 85 IKEFEIIDA-LCSNLKDEVLKISPVQKQTTAGQRTRFKAFVAIGDHAGHVGLGV 137 Score = 50.8 bits (116), Expect = 4e-07 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = +3 Query: 156 EDQKEWVPVTKLGRLVREGKIDKLESIYLFSLPSK 260 E + EW PVTKLGRLV+E KI LE IYL SLP K Sbjct: 52 EKETEWTPVTKLGRLVKEKKITTLEEIYLNSLPIK 86 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,248,870 Number of Sequences: 27780 Number of extensions: 141362 Number of successful extensions: 374 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 359 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 682028672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -