BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0237.Seq (594 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 26 0.21 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 26 0.21 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 26 0.21 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 26 0.28 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 23 1.9 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 1.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 1.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 1.9 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 3.4 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 21 7.8 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 26.2 bits (55), Expect = 0.21 Identities = 12/42 (28%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 459 ERSFTCVNCNGVFNSIRSLLMHL-VHAEHFAYRPPAECTFRY 337 E+ + C++CN F+ +L H+ H+ +R P C R+ Sbjct: 19 EKPYRCIDCNKSFSQAANLTAHVRTHSGEKPFRCPV-CDRRF 59 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 26.2 bits (55), Expect = 0.21 Identities = 12/42 (28%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 459 ERSFTCVNCNGVFNSIRSLLMHL-VHAEHFAYRPPAECTFRY 337 E+ + C++CN F+ +L H+ H+ +R P C R+ Sbjct: 275 EKPYRCIDCNKSFSQAANLTAHVRTHSGEKPFRCPV-CDRRF 315 Score = 21.8 bits (44), Expect = 4.5 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 505 YRSVRVQASSPRRR 546 Y+SV + SSPRRR Sbjct: 223 YKSVPMSFSSPRRR 236 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 26.2 bits (55), Expect = 0.21 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -1 Query: 459 ERSFTCVNCNGVFNSIRSLLMHLVHAEHFAYRPPA 355 E+ F C C G F L+ H E A R PA Sbjct: 244 EKPFECDKCRGRFRRRHHLVHHKCGGEEEAERAPA 278 Score = 21.4 bits (43), Expect = 5.9 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 468 TAKERSFTCVNCNGVFNSIRSLLMH 394 ++++R FTC CN F L H Sbjct: 129 SSRDRPFTCEVCNRSFGYKHVLQNH 153 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 25.8 bits (54), Expect = 0.28 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 447 TCVNCNGVFNSIRSLLMHLVHAEHF 373 TC C+ F+S++ L H+V H+ Sbjct: 549 TCKVCDQAFSSLKELSNHMVKNSHY 573 Score = 23.0 bits (47), Expect = 1.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -1 Query: 444 CVNCNGVFNSIRSLLMHLVHAEHFAYRPP 358 CV C F S+ ++ H+ A+H P Sbjct: 380 CVWCKQSFPSLAAMTTHMKEAKHCGVNVP 408 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 23.0 bits (47), Expect = 1.9 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 459 ERSFTCVNCNGVFNSIRSLLMH 394 +R F C CN F +LL+H Sbjct: 77 KRQFICKYCNRQFTKSYNLLIH 98 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.0 bits (47), Expect = 1.9 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 291 YVYYSFGRFKCGV 253 Y+ Y+FG+F C V Sbjct: 143 YICYAFGKFSCKV 155 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.0 bits (47), Expect = 1.9 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 291 YVYYSFGRFKCGV 253 Y+ Y+FG+F C V Sbjct: 376 YICYAFGKFSCKV 388 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.0 bits (47), Expect = 1.9 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 291 YVYYSFGRFKCGV 253 Y+ Y+FG+F C V Sbjct: 376 YICYAFGKFSCKV 388 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 22.2 bits (45), Expect = 3.4 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = -3 Query: 184 MGATYINEDASAVE*DAKQILWRS 113 +GA ++NE + ++ D +IL R+ Sbjct: 180 LGADWLNEQRAVIDFDNNEILLRN 203 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.0 bits (42), Expect = 7.8 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 509 ALFAFKLRLRDGALVVHIXKRMFD 580 AL KLRL DG + I ++ D Sbjct: 113 ALVPRKLRLADGGKTLEINYKLID 136 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,234 Number of Sequences: 336 Number of extensions: 2942 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -