BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0237.Seq (594 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 26 1.1 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 26 1.1 AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825766-1|AAV70329.1| 147|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825749-1|AAV70312.1| 130|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthe... 25 1.4 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 3.2 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 23 9.8 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 23 9.8 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 477 TSCTAKERSFTCVNCNGVFNSIRSLLMHLVHAE 379 +S T + CVN + +N + ++H VH E Sbjct: 1692 SSQTEMKPKQNCVNSSNTYNHVAESILHAVHDE 1724 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 25.8 bits (54), Expect = 1.1 Identities = 12/20 (60%), Positives = 17/20 (85%), Gaps = 2/20 (10%) Frame = +2 Query: 227 LTLLDV--RVATPHLNLPNE 280 +TLLDV R+ATP L++P+E Sbjct: 771 MTLLDVFTRIATPKLDVPSE 790 >AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 47 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 77 >AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 47 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 77 >AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825766-1|AAV70329.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 48 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 78 >AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 48 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 78 >AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 47 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 77 >AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 47 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 77 >AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 31 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 61 >AY825749-1|AAV70312.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 31 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 61 >AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 559 VYHQSAVAETKLEREQSDIISVYMKGNYILH 467 +Y Q + + E + ++ VY +G Y+LH Sbjct: 61 IYDQGFLVKVNDESSEFNVSLVYNRGGYVLH 91 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.2 bits (50), Expect = 3.2 Identities = 13/54 (24%), Positives = 28/54 (51%) Frame = -3 Query: 169 INEDASAVE*DAKQILWRS*IKD*VFFFLFIIYNM*RRNHRRFTCFK*INEMVK 8 +N D AV A Q++W ++D F +++ + R+H+ FK + +++ Sbjct: 1897 VNSDGCAVYEVAYQVIWICLVEDSALFLRYVLERL-TRDHQD-QMFKLLRHLIR 1948 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 22.6 bits (46), Expect = 9.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -2 Query: 128 NSVEVINKRLSFFFPLYY 75 N + V+ +SFFFP+ + Sbjct: 370 NEITVVMSLISFFFPMIF 387 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 22.6 bits (46), Expect = 9.8 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 471 CTAKERSFTCVNCNGVFNSIR 409 CT ++RS C+ C + IR Sbjct: 343 CTGQDRSKLCIKCGQEGHKIR 363 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 613,020 Number of Sequences: 2352 Number of extensions: 12212 Number of successful extensions: 68 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -