BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0237.Seq (594 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g26030.1 68417.m03748 hypothetical protein 31 0.77 At2g15740.1 68415.m01802 zinc finger (C2H2 type) family protein ... 28 4.1 >At4g26030.1 68417.m03748 hypothetical protein Length = 220 Score = 30.7 bits (66), Expect = 0.77 Identities = 11/31 (35%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = -1 Query: 462 KERSFTCVNCNGVFNSIRSLLMH--LVHAEH 376 K+ SF C+ CN +F++ + L++H L+H+++ Sbjct: 154 KDSSFICLKCNSLFDTSQMLVVHTELIHSKN 184 >At2g15740.1 68415.m01802 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 329 Score = 28.3 bits (60), Expect = 4.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 450 FTCVNCNGVFNSIRSLLMHL 391 +TC CNGVFN+ + H+ Sbjct: 244 YTCPKCNGVFNTSQKFAAHM 263 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,472,570 Number of Sequences: 28952 Number of extensions: 248338 Number of successful extensions: 605 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1180950720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -