BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0236.Seq (557 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56678| Best HMM Match : WD40 (HMM E-Value=6.4e-22) 28 5.9 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 >SB_56678| Best HMM Match : WD40 (HMM E-Value=6.4e-22) Length = 834 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 56 IPLKMTKYKCINSN-KCFSHY*N*YNDYLSKLCRRAIHFSQEKC 184 IP + C +S+ CFS N Y + + LC A+H S ++C Sbjct: 441 IPSSASHRLCADSHCNCFSMSNNLYINLSAFLCSIALHLSAQRC 484 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 27.9 bits (59), Expect = 5.9 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 89 NSNKCFSHY*N*YNDYLSKLCRRAIHFSQEKC 184 NS C SHY DY+SK CR++ F C Sbjct: 35 NSGFCKSHY-----DYMSKNCRKSCDFCGGSC 61 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,286,643 Number of Sequences: 59808 Number of extensions: 248585 Number of successful extensions: 502 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1300738331 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -