BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0235.Seq (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0065 - 12527642-12528178,12531443-12531718 28 3.6 03_05_0491 - 24868261-24869383,24869482-24869561,24870193-248702... 27 8.4 >10_07_0065 - 12527642-12528178,12531443-12531718 Length = 270 Score = 28.3 bits (60), Expect = 3.6 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -1 Query: 463 RHEQSTTAARVD--LHTHQARLQLAARRQPSARTGEAAF 353 R E+ + AAR D +HT + L AR S RT +AAF Sbjct: 231 RGEEKSQAARGDGAVHTRHSPPMLPARTPGSGRTDDAAF 269 >03_05_0491 - 24868261-24869383,24869482-24869561,24870193-24870249, 24870567-24870660,24871013-24871099,24871188-24871347, 24871440-24871674 Length = 611 Score = 27.1 bits (57), Expect = 8.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -1 Query: 91 SSTLNKKEGNYRNDSLSFKMKSRDWRI 11 +ST KKE +Y++ + K R WR+ Sbjct: 559 NSTKKKKEASYKHHKKPQRKKDRSWRV 585 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,153,315 Number of Sequences: 37544 Number of extensions: 81900 Number of successful extensions: 182 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 182 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -