BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0232.Seq (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 25 2.2 DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 23 8.8 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 24.6 bits (51), Expect = 2.2 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 83 DQIHSLPHPPQSNRKTKEDI 24 DQ H H PQ+ R ++DI Sbjct: 227 DQQHGAQHRPQTTRPNRQDI 246 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 22.6 bits (46), Expect = 8.8 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = -1 Query: 134 RSSDKVFRYSSDHRPDLDQIHSLPHPPQSNRKTKED 27 R +DK RY+ D + D + P + TK + Sbjct: 117 RLNDKCNRYNDDEEDEEDDFINSQSPSNDQQPTKRE 152 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 512,939 Number of Sequences: 2352 Number of extensions: 9581 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -