BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0229.Seq (419 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 23 4.5 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 6.0 AJ439060-2|CAD27753.1| 135|Anopheles gambiae putative cytoskele... 23 6.0 AJ438610-10|CAD27482.1| 135|Anopheles gambiae putative cytoskel... 23 6.0 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 23 6.0 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 23 6.0 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 22 7.9 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 23.0 bits (47), Expect = 4.5 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -2 Query: 319 LPSGADAYFSLVCSETNVQSLSSSKLDRNSC 227 LPS A ++VC + L K DR C Sbjct: 385 LPSLAGVNMAMVCRSNSYPQLEQVKQDRPIC 415 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 22.6 bits (46), Expect = 6.0 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +1 Query: 133 AGGEHHHRINMDKYHPGYFG 192 A HHH + +HPG G Sbjct: 153 AAAMHHHHHHPHHHHPGLTG 172 >AJ439060-2|CAD27753.1| 135|Anopheles gambiae putative cytoskeletal regulator protein. Length = 135 Score = 22.6 bits (46), Expect = 6.0 Identities = 8/25 (32%), Positives = 19/25 (76%) Frame = +1 Query: 313 MARSPSSILSKLDTTSC*AKANSPN 387 ++RS S++++ + T+C + A++PN Sbjct: 105 ISRSRSTVVNSYNLTTCPSWAHAPN 129 >AJ438610-10|CAD27482.1| 135|Anopheles gambiae putative cytoskeletal regulator protein. Length = 135 Score = 22.6 bits (46), Expect = 6.0 Identities = 8/25 (32%), Positives = 19/25 (76%) Frame = +1 Query: 313 MARSPSSILSKLDTTSC*AKANSPN 387 ++RS S++++ + T+C + A++PN Sbjct: 105 ISRSRSTVVNSYNLTTCPSWAHAPN 129 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 22.6 bits (46), Expect = 6.0 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +2 Query: 17 RNIEPWPPQKRRLGS*EVMLVTDMVVSEST 106 R +EPW + +RLG+ +V+ T++ + + Sbjct: 337 RELEPWRAEVKRLGT-QVIGTTEVFLDRES 365 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 22.6 bits (46), Expect = 6.0 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -1 Query: 146 CSPPALPRPPGCLRCFPI 93 C+PP +P P C P+ Sbjct: 38 CNPPGIPGGPACAGLKPM 55 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 22.2 bits (45), Expect = 7.9 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +1 Query: 148 HHRINMDKYHPGYFGK--LGMRNFHFR 222 +HRI +D+ H FG+ MR+ +R Sbjct: 111 NHRIQLDENHDPLFGRALFAMRDTRWR 137 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 435,202 Number of Sequences: 2352 Number of extensions: 7915 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -