BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0229.Seq (419 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 23 1.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 1.1 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 23 1.1 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 2.4 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 2.4 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 2.4 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 2.4 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 2.4 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 2.4 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 2.4 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 2.4 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 3.2 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 3.2 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 4.3 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 4.3 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 20 9.9 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 20 9.9 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 23.4 bits (48), Expect = 1.1 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 281 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQTPQT 388 +DEAE S+ G + QS I +VAR+ +T T Sbjct: 272 SDEAEPSSTSKKSGIVRSHQQSCINRVARETKTAGT 307 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 307 ADAYFSLVCSETNVQSLSSSKLDRNS 230 +D+ +S CS + Q S S + RNS Sbjct: 13 SDSGYSNTCSNSQSQRSSGSSISRNS 38 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 307 ADAYFSLVCSETNVQSLSSSKLDRNS 230 +D+ +S CS + Q S S + RNS Sbjct: 13 SDSGYSNTCSNSQSQRSSGSSISRNS 38 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.4 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 281 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 376 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.4 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 281 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 376 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.4 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 281 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 376 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.4 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 281 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 376 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.4 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 281 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 376 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.4 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 281 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 376 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 2.4 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 281 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 376 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 2.4 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 281 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 376 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.8 bits (44), Expect = 3.2 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = +2 Query: 326 RHQYCQSWILQVARQRQTPQT 388 RH ++W+ R + TPQ+ Sbjct: 241 RHLERKAWVASFGRPKMTPQS 261 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 273 VSEQTRLKYASAPDGKVPVI 332 V EQT A D KVP+I Sbjct: 230 VKEQTLQSIEMAKDAKVPII 249 Score = 21.0 bits (42), Expect = 5.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 223 KNKNFCPVLNLISFG 267 KNKN P +N+I G Sbjct: 471 KNKNLTPAVNIIVKG 485 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 4.3 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 266 DISL*TDEAEVCICSRWQGPRHQYCQ 343 D+S E + CI + Q R QYC+ Sbjct: 141 DLSYACREEKSCIIDKRQRNRCQYCR 166 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 4.3 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 266 DISL*TDEAEVCICSRWQGPRHQYCQ 343 D+S E + CI + Q R QYC+ Sbjct: 141 DLSYACREEKSCIIDKRQRNRCQYCR 166 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 20.2 bits (40), Expect = 9.9 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = -2 Query: 295 FSLVCSETNVQSLSSSKLDR 236 F ++CS ++ +L + LDR Sbjct: 104 FDVMCSTASILNLCAISLDR 123 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 20.2 bits (40), Expect = 9.9 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +2 Query: 317 QGPRHQYCQSW 349 +GPR YC W Sbjct: 567 KGPRTTYCAFW 577 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,081 Number of Sequences: 438 Number of extensions: 2436 Number of successful extensions: 18 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10750329 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -