BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0228.Seq (508 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB17E12.11 |||N-oligosaccharyltransferase gamma subunit |Schi... 27 2.1 SPAC23C4.19 |spt5||transcription elongation factor Spt5|Schizosa... 25 6.5 >SPAPB17E12.11 |||N-oligosaccharyltransferase gamma subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 309 Score = 26.6 bits (56), Expect = 2.1 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +3 Query: 225 RKRLINEAVSQK-WSKLTIVIMEILRFEFTFTILRRQKYAQK 347 RK ++ S+K W+ LTI+ + L + FT +R Y+Q+ Sbjct: 182 RKIIVKIFTSRKVWAALTIITVITLSSGYMFTRIRFSPYSQR 223 >SPAC23C4.19 |spt5||transcription elongation factor Spt5|Schizosaccharomyces pombe|chr 1|||Manual Length = 990 Score = 25.0 bits (52), Expect = 6.5 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = -1 Query: 310 VNSNLNISIITMVSLDHFWLTASFMSLLRNCLHGEHNYIVHKTY 179 V N+ S+ITMVS D L L + HG++ ++ Y Sbjct: 491 VVENVRGSVITMVSSDGLRLDVPSRGLRKRFRHGDYVKVIAGKY 534 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,948,154 Number of Sequences: 5004 Number of extensions: 36879 Number of successful extensions: 65 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -