BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0228.Seq (508 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27267| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) 28 3.8 SB_28788| Best HMM Match : RVP (HMM E-Value=0.028) 27 6.7 SB_23218| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) 27 6.7 SB_18007| Best HMM Match : RVP (HMM E-Value=0.047) 27 6.7 SB_17872| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) 27 6.7 SB_12598| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_8572| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) 27 6.7 SB_3903| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) 27 6.7 SB_3685| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) 27 6.7 SB_53519| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) 27 6.7 SB_46473| Best HMM Match : RVP (HMM E-Value=0.029) 27 6.7 SB_43861| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) 27 6.7 SB_29788| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) 27 6.7 SB_13078| Best HMM Match : RVP (HMM E-Value=0.039) 27 6.7 SB_11383| Best HMM Match : rve (HMM E-Value=2.3e-18) 27 6.7 SB_8937| Best HMM Match : RVP (HMM E-Value=0.029) 27 6.7 SB_59190| Best HMM Match : rve (HMM E-Value=6e-18) 27 8.9 >SB_27267| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) Length = 649 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIMFTKASV-IYVKLGKSRFEPKFIMY 421 H+Y+G IE+ L N P K K+M V + SR P+ + + Sbjct: 269 HTYFGSIEVGSVLQNQQPKKSLIKVMIAGKEVKLKXXXXDSRGSPEVLQF 318 >SB_28788| Best HMM Match : RVP (HMM E-Value=0.028) Length = 278 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIMFTKASV 370 H+Y+G IE+ L N P K K+M V Sbjct: 28 HTYFGSIEVGSVLQNQQPKKSLIKVMIAGKEV 59 >SB_23218| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) Length = 557 Score = 27.5 bits (58), Expect = 6.7 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIMFTKASVIYVKLGKSRFEP 406 H+Y+G IE+ L N P K K+M I K K +P Sbjct: 269 HTYFGSIEVGSVLQNQQPKKSLIKVMIAGKESITNKPLKRVHQP 312 >SB_18007| Best HMM Match : RVP (HMM E-Value=0.047) Length = 202 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIMFTKASV 370 H+Y+G IE+ L N P K K+M V Sbjct: 28 HTYFGSIEVGSVLQNQQPKKSLIKVMIAGKEV 59 >SB_17872| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) Length = 307 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIMFTKASV 370 H+Y+G IE+ L N P K K+M V Sbjct: 269 HTYFGSIEVGSVLQNQQPKKSLIKVMIAGKEV 300 >SB_12598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 799 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIMFTKASV 370 H+Y+G IE+ L N P K K+M V Sbjct: 28 HTYFGSIEVGSVLQNQQPKKSLIKVMIAGKEV 59 >SB_8572| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) Length = 1432 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIMFTKASV 370 H+Y+G IE+ L N P K K+M V Sbjct: 157 HTYFGSIEVGSVLQNQQPKKSLIKVMIAGKEV 188 >SB_3903| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) Length = 609 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIMFTKASV 370 H+Y+G IE+ L N P K K+M V Sbjct: 184 HTYFGSIEVGSVLQNQQPKKSLIKVMIAGKEV 215 >SB_3685| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) Length = 357 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIMFTKASV 370 H+Y+G IE+ L N P K K+M V Sbjct: 269 HTYFGSIEVGSVLQNQQPKKSLIKVMIAGKEV 300 >SB_53519| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) Length = 449 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIMFTKASV 370 H+Y+G IE+ L N P K K+M V Sbjct: 269 HTYFGSIEVGSVLQNQQPKKSLIKVMIAGKEV 300 >SB_46473| Best HMM Match : RVP (HMM E-Value=0.029) Length = 304 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIMFTKASV 370 H+Y+G IE+ L N P K K+M V Sbjct: 28 HTYFGSIEVGSVLQNQQPKKSLIKVMIAGKEV 59 >SB_43861| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) Length = 353 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIMFTKASV 370 H+Y+G IE+ L N P K K+M V Sbjct: 269 HTYFGSIEVGSVLQNQQPKKSLIKVMIAGKEV 300 >SB_29788| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) Length = 327 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIMFTKASV 370 H+Y+G IE+ L N P K K+M V Sbjct: 184 HTYFGSIEVGSVLQNQQPKKSLIKVMIAGKEV 215 >SB_13078| Best HMM Match : RVP (HMM E-Value=0.039) Length = 251 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIMFTKASV 370 H+Y+G IE+ L N P K K+M V Sbjct: 28 HTYFGSIEVGSVLQNQQPKKSLIKVMIAGKEV 59 >SB_11383| Best HMM Match : rve (HMM E-Value=2.3e-18) Length = 1003 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIMFTKASV 370 H+Y+G IE+ L N P K K+M V Sbjct: 28 HTYFGSIEVGSVLQNQQPKKSLIKVMIAGKEV 59 >SB_8937| Best HMM Match : RVP (HMM E-Value=0.029) Length = 303 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIMFTKASV 370 H+Y+G IE+ L N P K K+M V Sbjct: 28 HTYFGSIEVGSVLQNQQPKKSLIKVMIAGKEV 59 >SB_59190| Best HMM Match : rve (HMM E-Value=6e-18) Length = 660 Score = 27.1 bits (57), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 275 HSYYGDIEI*IYLYNTSPAKIRAKIM 352 H+Y+G IE+ L N P K K+M Sbjct: 28 HTYFGSIEVGSVLQNQQPKKSLIKVM 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,512,603 Number of Sequences: 59808 Number of extensions: 245916 Number of successful extensions: 431 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 430 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1111677931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -