Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0228.Seq
         (508 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g30430.1 68417.m04322 senescence-associated family protein si...    29   1.8  

>At4g30430.1 68417.m04322 senescence-associated family protein
           similar to senescence-associated protein 5 [Hemerocallis
           hybrid cultivar] gi|3551954|gb|AAC34855
          Length = 272

 Score = 29.1 bits (62), Expect = 1.8
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
 Frame = +3

Query: 27  LFWNILFLFYLKSVFVKACTIFTIIVT-KFS*ACTQNNSAFDYRIFCY 167
           L W+ LF+ +   + V   TIF  +VT K S    Q  +  +YR+  Y
Sbjct: 71  LLWSYLFVMFFLILIVLCFTIFAFVVTSKGSGETIQGKAYKEYRLEAY 118


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,435,856
Number of Sequences: 28952
Number of extensions: 170724
Number of successful extensions: 358
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 354
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 358
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 908059136
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)