BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0227.Seq (548 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21C3.06 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 26 4.2 SPAC23C4.18c |rad4|cut5, dre3|BRCT domain protein Rad4|Schizosac... 25 7.3 SPBC1604.04 |||thiamine pyrophosphate transporter|Schizosaccharo... 25 7.3 >SPBC21C3.06 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 122 Score = 25.8 bits (54), Expect = 4.2 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = +2 Query: 428 ILNLTQVMHIVTIIYSPFXIIRVVKLEN*EKFRVYA 535 + + T V+ + T ++ I+R + +EN ++F +YA Sbjct: 60 LFSFTSVLTVSTFTFASCLIMRTIGVENIKEFGLYA 95 >SPAC23C4.18c |rad4|cut5, dre3|BRCT domain protein Rad4|Schizosaccharomyces pombe|chr 1|||Manual Length = 648 Score = 25.0 bits (52), Expect = 7.3 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -1 Query: 86 LNVENASSIFKSLVYY 39 LN+EN + +FK+L +Y Sbjct: 294 LNIENEAKLFKNLTFY 309 >SPBC1604.04 |||thiamine pyrophosphate transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 314 Score = 25.0 bits (52), Expect = 7.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 246 WLTIHEL*SLIYQFNLIIHLTLFY 175 WL+ H S+IY N + +L FY Sbjct: 266 WLSCHFYYSIIYLLNSMFYLLTFY 289 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,969,613 Number of Sequences: 5004 Number of extensions: 34559 Number of successful extensions: 43 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -