BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0224.Seq (569 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0861 + 8153108-8153266,8154633-8155136 29 3.4 09_04_0202 - 15544498-15545037,15546043-15546449,15546874-155469... 27 8.0 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 27 8.0 >12_01_0861 + 8153108-8153266,8154633-8155136 Length = 220 Score = 28.7 bits (61), Expect = 3.4 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = -2 Query: 496 RKSPVSYFLSLPPRAGSG*FARLLPXLDVVAVSQAPSPESNP--DSPLPVTTMVVAE 332 R +P S S P G RL +VA+ + P P S+P D P TT+ + E Sbjct: 91 RAAPRSLLSSPSPHCQEGHDPRLCVSAGLVAIPRCPPPTSSPSLDPPESSTTVALIE 147 >09_04_0202 - 15544498-15545037,15546043-15546449,15546874-15546977, 15547580-15547788,15548092-15549428,15551680-15551941 Length = 952 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 442 THXRHGEVVTKNTIXDSYEAS*WNEXTLNILTRNKLEGKSG 564 T + V +T ++ E S + L ++ RNK GKSG Sbjct: 339 TSIQKPSVARNSTSLENMETSVYGPELLKVILRNKFRGKSG 379 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 27.5 bits (58), Expect = 8.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 424 PXLDVVAVSQAPSPESNPDSPLP 356 P LD ++Q PSP +NP P P Sbjct: 55 PPLDEETLAQFPSPPTNPSPPPP 77 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,635,750 Number of Sequences: 37544 Number of extensions: 332273 Number of successful extensions: 771 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 771 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1317005676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -