BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0223.Seq (499 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 26 0.82 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 24 3.3 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 3.3 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 5.8 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 5.8 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 7.6 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 25.8 bits (54), Expect = 0.82 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 91 CGLS*ILCPPIAVHDGGSR 35 CG S I PP A+H GGSR Sbjct: 874 CG-SGIASPPAAIHGGGSR 891 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 23.8 bits (49), Expect = 3.3 Identities = 28/72 (38%), Positives = 35/72 (48%), Gaps = 9/72 (12%) Frame = -2 Query: 288 RFLRCGLGNRHGD----ECGHFLSVL--NELYTD-AF-ADGRVGLLSFYTNFLEDDALCV 133 RFL LG + D E G ++ L NE + D A+ AD R LLS +FLED + Sbjct: 281 RFLFLLLGPQKTDLDYHEVGRSIATLMSNEHFHDIAYTADDREELLSAIDDFLEDSIVLP 340 Query: 132 RCTTERVS-LPF 100 ER LPF Sbjct: 341 PSKWERQGLLPF 352 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.8 bits (49), Expect = 3.3 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 60 MGGQRIQESPHGYEMEG*PFRWC 128 MG I SP G +M F WC Sbjct: 83 MGVMPIMRSPKGVDMPRTTFTWC 105 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -2 Query: 303 PLVLRRFLRCGLGNRHGDECG 241 P R+FL C G R +CG Sbjct: 301 PTDCRKFLNCNNGARFVQDCG 321 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -2 Query: 303 PLVLRRFLRCGLGNRHGDECG 241 P R+FL C G R +CG Sbjct: 300 PTDCRKFLNCNNGARFVQDCG 320 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 374 GYFYHLKTNSGNVTDGVTF 318 G+F+HL+ N G + TF Sbjct: 919 GFFFHLRKNMGGLKRFSTF 937 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 534,683 Number of Sequences: 2352 Number of extensions: 10486 Number of successful extensions: 18 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -