BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0221.Seq (517 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK129846-1|BAC85241.1| 236|Homo sapiens protein ( Homo sapiens ... 31 1.8 >AK129846-1|BAC85241.1| 236|Homo sapiens protein ( Homo sapiens cDNA FLJ26336 fis, clone HRT02842. ). Length = 236 Score = 31.5 bits (68), Expect = 1.8 Identities = 17/67 (25%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = -2 Query: 213 CLHQCYWNCQWPIHFHHDCLSYIHKCCYRRMY-WIL*GLCLHQCYWNCPWMIHFHHDCWN 37 C+H C + I+ H YIH Y +Y + +C+H C + C + + Sbjct: 66 CIHICIF-----IYTHMHTYMYIHIHAYAYIYVYSYTRICIHICVFICTHAYIYVYSYVQ 120 Query: 36 CIHKCCY 16 C+H C + Sbjct: 121 CMHMCIH 127 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,446,226 Number of Sequences: 237096 Number of extensions: 1215635 Number of successful extensions: 3348 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3348 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4876707572 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -