BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= msgV0221.Seq
(517 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AK129846-1|BAC85241.1| 236|Homo sapiens protein ( Homo sapiens ... 31 1.8
>AK129846-1|BAC85241.1| 236|Homo sapiens protein ( Homo sapiens
cDNA FLJ26336 fis, clone HRT02842. ).
Length = 236
Score = 31.5 bits (68), Expect = 1.8
Identities = 17/67 (25%), Positives = 29/67 (43%), Gaps = 1/67 (1%)
Frame = -2
Query: 213 CLHQCYWNCQWPIHFHHDCLSYIHKCCYRRMY-WIL*GLCLHQCYWNCPWMIHFHHDCWN 37
C+H C + I+ H YIH Y +Y + +C+H C + C + +
Sbjct: 66 CIHICIF-----IYTHMHTYMYIHIHAYAYIYVYSYTRICIHICVFICTHAYIYVYSYVQ 120
Query: 36 CIHKCCY 16
C+H C +
Sbjct: 121 CMHMCIH 127
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 60,446,226
Number of Sequences: 237096
Number of extensions: 1215635
Number of successful extensions: 3348
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3225
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3348
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4876707572
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -