BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0220.Seq (499 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ335469-1|ABC59821.1| 5005|Homo sapiens fragile site-associated... 29 9.0 AB029032-1|BAA83061.2| 3086|Homo sapiens KIAA1109 protein protein. 29 9.0 >DQ335469-1|ABC59821.1| 5005|Homo sapiens fragile site-associated protein protein. Length = 5005 Score = 29.1 bits (62), Expect = 9.0 Identities = 16/69 (23%), Positives = 32/69 (46%) Frame = +3 Query: 171 RAAGGAKLPSAGLCLNASKAEASLAESGRICSLWSPESREALNNVTLLVAFRIQNARRDV 350 R+ G + S + +ASK + +L +C + S + + ++ ++AF RR + Sbjct: 4217 RSGGASFFESQSVSKSASKMDTTLINISAVCDIGSASFKYDMRRLSEILAFPRAWYRRSI 4276 Query: 351 EAHLDRGDR 377 L GD+ Sbjct: 4277 ARRLFLGDQ 4285 >AB029032-1|BAA83061.2| 3086|Homo sapiens KIAA1109 protein protein. Length = 3086 Score = 29.1 bits (62), Expect = 9.0 Identities = 16/69 (23%), Positives = 32/69 (46%) Frame = +3 Query: 171 RAAGGAKLPSAGLCLNASKAEASLAESGRICSLWSPESREALNNVTLLVAFRIQNARRDV 350 R+ G + S + +ASK + +L +C + S + + ++ ++AF RR + Sbjct: 2298 RSGGASFFESQSVSKSASKMDTTLINISAVCDIGSASFKYDMRRLSEILAFPRAWYRRSI 2357 Query: 351 EAHLDRGDR 377 L GD+ Sbjct: 2358 ARRLFLGDQ 2366 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,563,896 Number of Sequences: 237096 Number of extensions: 1510577 Number of successful extensions: 3349 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3269 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3349 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4536472160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -