BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0218.Seq (584 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006615-6|AAK68228.1| 531|Caenorhabditis elegans Hypothetical ... 28 4.2 AF003133-3|AAB54138.2| 2192|Caenorhabditis elegans Low-density l... 27 9.8 >AC006615-6|AAK68228.1| 531|Caenorhabditis elegans Hypothetical protein C36B7.2 protein. Length = 531 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/51 (21%), Positives = 27/51 (52%) Frame = -3 Query: 417 KRIIVVILGRVTPRAFIFVEDVLYVSSVNQRSVTSCVRT*VQKFFYEFLFI 265 +++ + ++ ++ PR + E ++Y+SS++ CVR F F ++ Sbjct: 219 QKVAIRMVSKLAPRIYRETEMIMYISSIDPDHTFDCVRMLDYNVFRGFHYV 269 >AF003133-3|AAB54138.2| 2192|Caenorhabditis elegans Low-density lipoprotein receptorrelated protein 2 protein. Length = 2192 Score = 27.1 bits (57), Expect = 9.8 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -2 Query: 493 STEKDSKKKCVAVCEEILILAIWLSQTDHSCNFGA 389 S EK KK+C VC+ + A L CN G+ Sbjct: 1022 SDEKGCKKECAIVCDNSCVHADDLCDGKKKCNDGS 1056 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,629,665 Number of Sequences: 27780 Number of extensions: 253315 Number of successful extensions: 553 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 553 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1226509528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -