BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0217.Seq (518 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4YCU3 Cluster: Putative uncharacterized protein; n=1; ... 33 5.2 UniRef50_Q23TW7 Cluster: Importin-beta N-terminal domain contain... 33 5.2 >UniRef50_Q4YCU3 Cluster: Putative uncharacterized protein; n=1; Plasmodium berghei|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 86 Score = 32.7 bits (71), Expect = 5.2 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +2 Query: 251 ISEGCKEVEAKVLIQNIQQILHFXTLIALIXFSENQXVFCLLNNII 388 I C + A + + +++I+HF I FS+ FC++NNII Sbjct: 41 IHRRCMFIHAFNIYKYVKKIIHFFIKILYKLFSKMDDYFCVINNII 86 >UniRef50_Q23TW7 Cluster: Importin-beta N-terminal domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: Importin-beta N-terminal domain containing protein - Tetrahymena thermophila SB210 Length = 1036 Score = 32.7 bits (71), Expect = 5.2 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +2 Query: 329 IALIXFSENQXVFCLLNNIIEMFXHEPTVNFY*LLNNISVVFY 457 I L+ +N+ + C L I+E F +E T Y L N++S+ FY Sbjct: 555 IKLMQQIDNENLVCALECIVENFTNEITPFAYDLANHLSIAFY 597 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 346,915,252 Number of Sequences: 1657284 Number of extensions: 4814982 Number of successful extensions: 6006 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5924 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6005 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32201017387 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -