Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0217.Seq
         (518 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY391745-1|AAR28995.1|  460|Anopheles gambiae putative GPCR prot...    26   0.66 

>AY391745-1|AAR28995.1|  460|Anopheles gambiae putative GPCR
           protein.
          Length = 460

 Score = 26.2 bits (55), Expect = 0.66
 Identities = 16/64 (25%), Positives = 28/64 (43%), Gaps = 2/64 (3%)
 Frame = -2

Query: 211 FSRTRLKH--SRYLIKSMNICENQYSFVIXIKVCSILYL*PIDNS*YCNFATHTNLIISX 38
           F  T+LK   S Y + ++ I +  Y   + +   S   +       YC   T+T+ + S 
Sbjct: 64  FFNTKLKKLSSSYYLAALGISDTCYLVGLFVTWLSFFQVHIYTREPYCQLFTYTSGVSSF 123

Query: 37  LLIW 26
           L +W
Sbjct: 124 LSVW 127


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 374,662
Number of Sequences: 2352
Number of extensions: 4930
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 47360208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)